Identifiers and Description

Gene Model Identifier

TTHERM_000697499

Standard Name

SNM1 (homolog of Sensitive to Nitrogen Mustard 1 (SNM1) nuclease)

Aliases

None

Description

kinase domain protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 15%

TetraMine Data

TTHERM_000697499

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18118.19.997093137033517e-262hypothetical protein (719 aa)
OxytrichaContig13766.0.g882.9994376937714457e-52DNA repair metallo-beta-lactam
ase
DictyBaseDDB_G02777559.99723014177113e-33dclre1 on chromosome: 2 positi
on 8451915 to 8454935
Stentor CoeruleusSteCoe_288134.780892883885469e-25
WormBaseWBGene000452379.000561397357242e-21locus:mrt-1 status:Confirmed
UniProt:Q8T3E0 protein_id
:CAD30439.1
SGDYMR137C9.997019043202629e-21PSO2 Nuclease required for a p
ost-incision step in the repai
r of DNA single and double-str
and breaks that result from in
terstrand crosslinks produced
by a variety of mono- and bi-f
unctional psoralen derivatives
; induced by UV-irradiation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_000697499(coding)
ATGGTACTTATTAGCTTTACTAACATAGTTGTGGACGAGTTTTCTTATGGTAAAAGACAC
CCATTAAAAAAATATATTTATTTTTTAACTCATATGCATTCAGATCATTATTAAGGTATA
ACACCTAATTGGAATTTTGGTACAATTTATTGCTCAGAAGTGACAAAAAAATTACTACTT
AACAAGTTTCCATAATTACAAGATGTCAGAGAGTTGGAAATGAACAAATAGTAGAAGATT
TGCTTAAATTAAGAAAATAAAATTGAAATTAATGTCTACTTGTTTGATGCAAATCATTGT
CCTGGATCAGTCATGTTCATGTTTGAAGGATATTTTGGAAGAATTCTTCATACTGGTGAT
ATGAGATTTAATGAGAATTTAATATATAATAATCCAATATTGTATCCTATTGAAAAACGT
AATTCTGAACTTAAGAAAATATCATTATAAATAGACGAATGTATATTTGATAACACTTAT
TGTGATCCTATCTTTAAATTTCCCAAGAGAGAAAAGGCATGCTAAATGCTAACAGAAATT
ATAGATAAACATAAAAATATCCCTAATGTTAGAATTCTAATTTGTGTTGACTCTTTAGGT
AAAGAAGAACTTCTTGTTTTTCTCTCTAAACACTATGAAACTCTTATTGTGGTAAATGAG
TAGCGTTATTAAAGCATACTTTGTATGGATATCCCATACTAACTCTTCACCACAAATAGG
GATCAGGGTTGGATTGAAGTTATAAGGAAAAACGAAAAATAAGAAAGAATGGAATCAAAA
AATGAATATTGTGTTAGCATTACTTGCACAGGTTGGGCTAATATACAAGGATACATAACT
AAAGATGATAGAAATTATCTACTACCTTATAGTTTGCACAGCAATTTTGAAGAGCTAGAG
CTGTTTATTAGAAGTATATACCCTAGTGTTTTGAATACAGTAGTTAGAAATTAGGCAAAG
GGGGAAAAAATTAATAATATTACTTAATTTTCAGCTTATATGGTGACGTTGATGAATTTA
AAATAGCGTGGAGTCGAGTTTTTCTAAAAAAATTATATAGATTTTAGCACAATATCTAAA
AACTATTAGAATTTAATGTTAAATTAAGAAAATGTTTCAAAAATTAATAAAGCATTAGGT
CTTGAGCTAAGTGAAAAAGATAAACTCGTAGAAGATACCATTGATTTTTAATCTAAACAC
TCATAAATTTTTAAAAATAAAAAAAGACTGAAAAAGGGAGCTCAACTTGCAGATCCTACT
GAAAATAATTCAATTTGCATTGATAAATTTATTGAAATTAAAAAAAGTATAGAATTAATA
AAGGAAATGAAGGCAAAATCAAAAGAGAGTTCAGCAAAAAGTTCTCTTAAAAAGAATTCA
GTGAAAAGAAAATAAAATTTTGAGAGCGAAAATGAATAAGATTATGATCAAAATCATGAG
AATGATGAGTTTGATGAGAGTTTTAAAAACTAAGGTGATGATCATAATTTCTTGAGTGAA
AAATAAATTAGTCAGTAAAAACAAGATGATGAGGATAATAGAAGCATTTCTTCAAAAATA
AATCAAATTAATTAAAAGCTGACAGATCATTTAAATAAACAGAAATTCCAAACAGAGTAG
TAGTATGAAAAAGATGGGGAAGGTGATGATGAACAAGAAGAAGGATATGAAGAAAATAAT
AATTTAATAAACTAAAAACTTAAAAAAGCTACTACTTATCAAAGATTTAGCTCAGAAATA
GCTTTTAATTCAACCTAATCCAAAAGTCCTCCTTCAGAAAAATGTGAAGACGTTTTAGAT
AAATTTATGCTTAAAAAGATAGTAAAAGCAAATACAATAAATTAACAAAACTAAAATTCT
TTAAAAAATACTTCTAATAATGAGTATAGTAACACATAGGCAAGTTAATCAAGTAATGGG
ATAGCGAAAAAAAAATAAATTAAAATTAAAATTTCTAAGAAAATTAGTATGGATAAATTT
GATAATAGTAACAATAATAATAATAATAATAATGATAATAATAGCAATGACTAAGAAGAA
GTTTTAGAATAAAAAAATTTCTAAAAAATTATTGAGTAAAAAGAAGATACTACAAATACT
TATCTTTAAGAAAAATAAAATGAAGAAAATGTTTCTTCAAGATCGTCAGAAATAAATAAG
GAAATACCTGTCTTTAGAAATTCTTCATTAAATAAAATATTTAATTAATTTCTTAATAAA
TAATGA


>TTHERM_000697499(protein)
MVLISFTNIVVDEFSYGKRHPLKKYIYFLTHMHSDHYQGITPNWNFGTIYCSEVTKKLLL
NKFPQLQDVRELEMNKQQKICLNQENKIEINVYLFDANHCPGSVMFMFEGYFGRILHTGD
MRFNENLIYNNPILYPIEKRNSELKKISLQIDECIFDNTYCDPIFKFPKREKACQMLTEI
IDKHKNIPNVRILICVDSLGKEELLVFLSKHYETLIVVNEQRYQSILCMDIPYQLFTTNR
DQGWIEVIRKNEKQERMESKNEYCVSITCTGWANIQGYITKDDRNYLLPYSLHSNFEELE
LFIRSIYPSVLNTVVRNQAKGEKINNITQFSAYMVTLMNLKQRGVEFFQKNYIDFSTISK
NYQNLMLNQENVSKINKALGLELSEKDKLVEDTIDFQSKHSQIFKNKKRLKKGAQLADPT
ENNSICIDKFIEIKKSIELIKEMKAKSKESSAKSSLKKNSVKRKQNFESENEQDYDQNHE
NDEFDESFKNQGDDHNFLSEKQISQQKQDDEDNRSISSKINQINQKLTDHLNKQKFQTEQ
QYEKDGEGDDEQEEGYEENNNLINQKLKKATTYQRFSSEIAFNSTQSKSPPSEKCEDVLD
KFMLKKIVKANTINQQNQNSLKNTSNNEYSNTQASQSSNGIAKKKQIKIKISKKISMDKF
DNSNNNNNNNNDNNSNDQEEVLEQKNFQKIIEQKEDTTNTYLQEKQNEENVSSRSSEINK
EIPVFRNSSLNKIFNQFLNKQ


>TTHERM_000697499(gene)
ATGGTACTTATTAGCTTTACTAACATAGTTGTGGACGAGTTTTCTTATGGTAAAAGACAC
CCATTAAAAAAATATATTTATTTTTTAACTCATATGCATTCAGGTAATTTTATTATTTAT
TATATAAATATAAATGAACTCATTTGTAAATTCATATAAAGATCATTATTAAGGTATAAC
ACCTAATTGGAATTTTGGTACAATTTATTGCTCAGAAGTGACAAAAAAATTACTACTTAA
CAAGTTTCCATAATTACAAGATGTCGTAAGGATTCATTAGAGTTTAGGATGCATTTATTT
ATTAATTTTACTTATTTGCTTATTACATTAGAGAGAGTTGGAAATGAACAAATAGTAGAA
GATTTGCTTAAATTAAGAAAATAAAATTGAAATTAATGTCTACTTGTTTGATGCAAATCA
TTGTCCTGGTAACATAATAATTTATTTTAACTATAATTGTGAATTTTTATATGAAAGTTA
ATTAAAATTAATAATATTAAATATTTAAATAAACTAAAGGATCAGTCATGTTCATGTTTG
AAGGATATTTTGGAAGAATTCTTCATACTGGTGATATGAGATTTAATGAGAATTTAATAT
ATAATAATCCAATATTGTATCCTATTGAAAAACGTAATTCTGAACTTAAGAAAATATCAT
TATAAATAGACGAATGTATATTTGATAACACTTATTGTGATCCTATCTTTAAATTTCCCA
AGAGAGAAAAGGCATGCTAAATGCTAACAGAAATTATAGATAAACATAAAAATATCCCTA
ATGTTAGAATTCTAATTTGTGTTGACTCTTTAGGTAAAGAAGAACTTCTTGTTTTTCTCT
CTAAACACTATGAAACTCTTATTGTGGTAAATGAGTAGCGTTATTAAAGCATACTTTGTA
TGGATATCCCATACTAACTCTTCACCACAAATAGGGATCAGGGTTGGATTGAAGTTATAA
GGAAAAACGAAAAATAAGAAAGAATGGAATCAAAAAATGAATATTGTGTTAGCATTACTT
GCACAGGTTGGGCTAATATACAAGGATACATAACTAAAGATGATAGAAATTATGTAAAAT
TTAATTATTTGTTATTTATTTAAAGCTTAATTTGAGCTTTTTAGAGACCATAAGATTTTC
CTCTAAAATAAAATTAAATAAAATTCATTTTAATTAATTTAATTATTTAATTTAAATAGC
TACTACCTTATAGTTTGCACAGCAATTTTGAAGAGCTAGAGCTGTTTATTAGAAGTATAT
ACCCTAGTGTTTTGAATACAGTAGTTAGAAATTAGGCAAAGGGGGAAAAAATTAATAATA
TTACTTAATTTTCAGCTTATATGGTGACGTTGATGAATTTAAAATAGCGTGGAGTCGAGT
TTTTCTAAAAAAATTATATAGATTTTAGCACAATATCTAAAAACTATTAGAATTTAATGT
TAAATTAAGAAAATGTTTCAAAAATTAATAAAGCATTAGGTCTTGAGCTAAGTGAAAAAG
ATAAACTCGTAGAAGATACCATTGATTTTTAATCTAAACACTCATAAATTTTTAAAAATA
AAAAAAGACTGAAAAAGGGAGCTCAACTTGCAGATCCTACTGAAAATAATTCAATTTGCA
TTGATAAATTTATTGAAATTAAAAAAAGTATAGAATTAATAAAGGAAATGAAGGCAAAAT
CAAAAGAGAGTTCAGCAAAAAGTTCTCTTAAAAAGAATTCAGTGAAAAGAAAATAAAATT
TTGAGAGCGAAAATGAATAAGATTATGATCAAAATCATGAGAATGATGAGTTTGATGAGA
GTTTTAAAAACTAAGGTGATGATCATAATTTCTTGAGTGAAAAATAAATTAGTCAGTAAA
AACAAGATGATGAGGATAATAGAAGCATTTCTTCAAAAATAAATCAAATTAATTAAAAGC
TGACAGATCATTTAAATAAACAGAAATTCCAAACAGAGTAGTAGTATGAAAAAGATGGGG
AAGGTGATGATGAACAAGAAGAAGGATATGAAGAAAATAATAATTTAATAAACTAAAAAC
TTAAAAAAGCTACTACTTATCAAAGATTTAGCTCAGAAATAGCTTTTAATTCAACCTAAT
CCAAAAGTCCTCCTTCAGAAAAATGTGAAGACGTTTTAGATAAATTTATGCTTAAAAAGA
TAGTAAAAGCAAATACAATAAATTAACAAAACTAAAATTCTTTAAAAAATACTTCTAATA
ATGAGTATAGTAACACATAGGCAAGTTAATCAAGTAATGGGATAGCGAAAAAAAAATAAA
TTAAAATTAAAATTTCTAAGAAAATTAGTATGGATAAATTTGATAATAGTAACAATAATA
ATAATAATAATAATGATAATAATAGCAATGACTAAGAAGAAGTTTTAGAATAAAAAAATT
TCTAAAAAATTATTGAGTAAAAAGAAGATACTACAAATACTTATCTTTAAGAAAAATAAA
ATGAAGAAAATGTTTCTTCAAGATCGTCAGAAATAAATAAGGAAATACCTGTCTTTAGAA
ATTCTTCATTAAATAAAATATTTAATTAATTTCTTAATAAATAATGA