Identifiers and Description

Gene Model Identifier

TTHERM_00449090

Standard Name

SNF8 (Sucrose NonFermenting )

Aliases

PreTt15427 | 52.m00205 | 3811.m00962

Description

Component of the ESCRT-II complex

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00449090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14986.14.999555668078159e-151hypothetical protein (246 aa)
WormBaseWBGene000161677.996210139153865e-29locus:vps-22 status:Confirme
d UniProt:Q18258 protein_i
d:CCD65742.1
DictyBaseDDB_G02832032.9993110246221282e-28vps22 on chromosome: 4 positio
n 415279 to 416235
SGDYPL002C7.000924640675686e-24SNF8 Component of the ESCRT-II
complex, which is involved in
ubiquitin-dependent sorting o
f proteins into the endosome;
appears to be functionally rel
ated to SNF7; involved in gluc
ose derepression
OxytrichaContig10454.0.g126.996829646809514e-23EAP30/Vps36 family

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00449090(coding)
ATGTATGGCGGTAAATAAGCAATGATGAAGTAGCTAGAATAGCAATAAGCTAGATAGCAG
ATGGGATAGTAGTTAATGCAGCAGAAAATTACAAGAATGAAGGACATTTATAATGTTTTT
TAAGAAAATATGCAAAAATACGCTGCATAATATGCTAATGAAATCAATAAAGATCCAAAC
TTTAGAGACAACTTTAATTAGCTCTGCTAAAATTTAGGCATAGATCCTATGATATCATAA
AAAACCTTATTTTCAAACCTTGGATTTGGAGATTTCTACAACGAATTAGCAATGAAGATT
TTGGATATTACAGCCCGTAAAAGAAATGAGAATGGTGGAATGATGAAATTGATTGACATC
ATTAATGAATTCGAAAAAAGATATAAAACAAAGATATCCAAGAAAGACATTTAAGAAGCC
TTAAAAACAATAACTTGTCTTGGTGGTTGTCAGTTAGTTAACAATGAGTATGTAAGCACT
TCTAACTTATCTATGTCAGGGGACTTTAATAGTGTAATTGAAATTGCTGAAAAGTATGGT
CATGTCAGTGAGTAGCTTATGAAAGAATAAAAAGGATGGAATAAAGACAAATTTAAATTA
GTAATAGATTAGCTGAGAGGAGAAGGCATGGTTTGGGTAGATAAAAAAACTCAGTCTGGT
CTACCTAATTATTATTTCCCCTCCATGCTTAATAGCTTTGTTGATAATTTATAAGAATTC
AGTAAATATATTAAATGA


>TTHERM_00449090(protein)
MYGGKQAMMKQLEQQQARQQMGQQLMQQKITRMKDIYNVFQENMQKYAAQYANEINKDPN
FRDNFNQLCQNLGIDPMISQKTLFSNLGFGDFYNELAMKILDITARKRNENGGMMKLIDI
INEFEKRYKTKISKKDIQEALKTITCLGGCQLVNNEYVSTSNLSMSGDFNSVIEIAEKYG
HVSEQLMKEQKGWNKDKFKLVIDQLRGEGMVWVDKKTQSGLPNYYFPSMLNSFVDNLQEF
SKYIK


>TTHERM_00449090(gene)
ATGTATGGCGGTAAATAAGCAATGATGAAGTAGCTAGAATAGCAAGTAATGAGCATAAAA
TATTTTTGTTTCTTTAGAACATTACTTTTAAATTTAGGTTTGACAATTATAATATAATTT
GTTTCTAATAGTAAGCTAGATAGCAGATGGGATAGTAGTTAATGCAGCAGAAAATTACAA
GAGTAAAAAATATTTATGATTAGTCTTGCAGTCATTAAATAAACTAACTTATTTTATGGA
TTATTAATTTAGATGAAGGACATTTATAATGTTTTTTAAGAAAATATGCAAAAATACGCT
GCATAATATGCTAATGAAATCAATAAAGATCCAAACTTTAGAGACAACTTTAATTAGCTC
TGCTAAAATTTAGGCATAGATCCTATGATATGTAGCTTAATATTATTTTCTTAAACTGTT
TTTAGCATTATATTCTTACTTTAACAAACAAATAGCATAAAAAACCTTATTTTCAAACCT
TGGATTTGGAGATTTCTACAACGAATTAGCAGTAAATTTGATATTGAAAAGTAATAGATA
AGCAACAAGTATTATAATTAAATTAATAAAATAGATGAAGATTTTGGATATTACAGCCCG
TAAAAGAAATGAGAATGGTGGAATGATGAAATTGATTGACATCATTAATGAATTCGAAAA
AAGATATAAAACAAAGATATCCAAGTAAATATAGAAAGCAATCAATCAATATATTTTAAT
AAACTGCAAAATACTATTTTTAGTAATTTAAAAAAATTAATCCTTTTTTATTTTAAAGGA
AAGACATTTAAGAAGCCTTAAAAACAATAACTTGTCTTGGTGGTTGTCAGTTAGTTAACA
ATGAGTATGTAAGCACTTCTAACTTATCTATGTCAGGGGACTTTAATAGTGTAATTGAAA
TTGCTGAAAAGGTAATCAATATTTTTATTTGTTAAAATGATTTAATCAATAATTCATTTT
ATTCCATAGTATGGTCATGTCAGTGAGTAGCTTATGAAAGAATAAAAAGGATGGAATAAA
GACAAATTTAAATTAGTAATAGATTAGCTGAGAGGAGAAGGCATGGTTTGGGTAGATAAA
AAAACTCAGTCTGGTCTACCTAATTATTATTTCCCCTCCATGCTTAATAGCTTTGTTGAT
AATTTATAAGAATTCAGTAAATATATTAAATGA