Identifiers and Description

Gene Model Identifier

TTHERM_00304150

Standard Name

SNF5

Aliases

PreTt21221 | 29.m00182 | 3696.m00005

Description

Conserved protein. Member of the SWI/SNF complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00304150

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11574.19.997093137033517e-262hypothetical protein (354 aa)
OxytrichaContig1260.1.g265.997739233660418e-28SNF5 / SMARCB1 / INI1
WormBaseWBGene000111112.9990241513684e-21locus:snfc-5 status:Confirme
d UniProt:Q21831 protein_i
d:CAA83625.1
SGDYLR321C9.004296568159186e-20SFH1 Component of the RSC chro
matin remodeling complex; esse
ntial gene required for cell c
ycle progression and maintenan
ce of proper ploidy; phosphory
lated in the G1 phase of the c
ell cycle; Snf5p paralog
Stentor CoeruleusSteCoe_107968.533047625744066e-17
DictyBaseDDB_G02793737.003160085026828e-16snf5 on chromosome: 3 position
2004876 to 2006425

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00304150(coding)
ATGTCTTTAACTGTAACTTATAATAGTGGAATGGTTAAAAAGCCATTATACTAAAGAGTA
CACGAAGTACTTAATCGCTTAGGTTTATTTTATCAAGACATTTGTGTGGAGGCAAATATA
AATGAAGAAAGTTTGATTTAGTGGGTAAACTAAGACCCTGAATATGATTATGCCGAATTA
GAGCTTTCTCTTGAGAAATGGATAGATTCAAAGTACTAGCGTTCATAGAACAATGATGAA
AAATAATATTATTAAATTCGTTCTCAATATTTAAAAAGATTAGATATAAATTAATAGCTA
GCAAACTAATGGCTAGAGGCACCAAATATTGATAAAATTCCTTAAAATGACCAACCAAAT
GAGTATCTAATACCTATAAGCATTGATATTGAATTGGATGGATAGACTTTTAAAGAAAAT
ATAATTTGGAATTATTATGAACCATATTTTACTCCAGAAAACTTTGCTCATCACTTAGCA
AAAGAAAACAGATTAAGTCCTAATATAGAATAAGAAGTAGTTAATGTAATCCGCAGAGCT
CTTTAAAACTATCGCTTCTACGATCCTAAGGAAAGAGAGCTCATCCGTACTATTGAATTA
AATATATTGATAGAAAATGTATAGCTAAAAGATAGATTTGAGTGGGATATTAATGATTTC
ACAAATTCTCCAGAATAATTTGCTTTTAATATGTGCAATGAATTAGGTCTTAGTGGAGAA
TTTGCATAGAGAATAGCGTATTAAATAAGAGAATAGATTCTCTCCTTCTAAAAATAAATT
ATGGAAAGACGTATAAACTAAACTGCATCTAATTTCAAGAAGTCTACTCGTTCTTTAATT
GAATCCTCTTAAAATTTCACAAACTTTGACCCCAAAATTCACATCTAAGGAAATACAGTA
ATTACAGAAGAAAATTATTTACGTCCTGTACTTTAAGATAATGATTATGATAGTTTTCAA
TGGGAGCCAAAAATTTCAATCTTATAACCAGATGATATTAGAAAGGTATAGAAAGAAGAA
TAGAGAAAGCAACGTCTTATGCGTAGAACTCGTTGA


>TTHERM_00304150(protein)
MSLTVTYNSGMVKKPLYQRVHEVLNRLGLFYQDICVEANINEESLIQWVNQDPEYDYAEL
ELSLEKWIDSKYQRSQNNDEKQYYQIRSQYLKRLDINQQLANQWLEAPNIDKIPQNDQPN
EYLIPISIDIELDGQTFKENIIWNYYEPYFTPENFAHHLAKENRLSPNIEQEVVNVIRRA
LQNYRFYDPKERELIRTIELNILIENVQLKDRFEWDINDFTNSPEQFAFNMCNELGLSGE
FAQRIAYQIREQILSFQKQIMERRINQTASNFKKSTRSLIESSQNFTNFDPKIHIQGNTV
ITEENYLRPVLQDNDYDSFQWEPKISILQPDDIRKVQKEEQRKQRLMRRTR


>TTHERM_00304150(gene)
ATGTCTTTAACTGTAACTTATAATAGTGGAATGGTTAAAAAGCCATTATACTAAAGAGTA
CACGAAGTACTTAATCGCTTAGGTTTATTTTATCAAGACATTTGTGTGGAGGCAAATATA
AATGAAGAAAGTTTGATTTAGTGGGTAAACTAAGACCCTGAATATGATTATGCCGAATTA
GAGCTTTCTCTTGAGAAATGGATAGATTCAAAGTACTAGCGTTCATAGAACAATGATGAA
AAATAATATTATTAAATTCGTTCTCAATATTTAAAAAGATTAGATATAAATTAATAGCTA
GCAAACTAATGGCTAGAGGCACCAAATATTGATAAAATTCCTTAAAATGACCAACCAAAT
GAGTATCTAATACCTATAAGCATTGATATTGAATTGGATGGATAGACTTTTAAAGAAAAT
ATAATTTGGAATTATTATGAACCATATTTTACTCCAGAAAACTTTGCTCATCACTTAGCA
AAAGAAAACAGATTAAGTCCTAATATAGAATAAGAAGTAGTTAATGTAATCCGCAGAGCT
CTTTAAAACTATCGCTTCTACGATCCTAAGGAAAGAGAGCTCATCCGTACTATTGAATTA
AATATATTGATAGAAAATGTATAGCTAAAAGATAGATTTGAGTGGGATATTAATGATTTC
ACAAATTCTCCAGAATAATTTGCTTTTAATATGTGCAATGAATTAGGTCTTAGTGGAGAA
TTTGCATAGAGAATAGCGTATTAAATAAGAGAATAGATTCTCTCCTTCTAAAAATAAATT
ATGGAAAGACGTATAAACTAAACTGCATCTAATTTCAAGAAGTCTACTCGTTCTTTAATT
GAATCCTCTTAAAATTTCACAAACTTTGACCCCAAAATTCACATCTAAGGAAATACAGTA
ATTACAGAAGAAAATTATTTACGTCCTGTACTTTAAGATAATGATTATGATAGTTTTCAA
TGGGAGCCAAAAATTTCAATCTTATAACCAGATGATATTAGAAAGGTATAGAAAGAAGAA
TAGAGAAAGCAACGTCTTATGCGTAGAACTCGTTGA