Identifiers and Description

Gene Model Identifier

TTHERM_00388250

Standard Name

SNF2

Aliases

PreTt24820 | 41.m00227

Description

SNF2 family N-terminal domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF09110 ) HAND
  • ( PF09111 ) SLIDE
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF09312 ) SurA N-terminal domain
  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF00176 ) SNF2 family N-terminal domain
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF01814 ) Hemerythrin HHE cation binding domain
  • ( PF04851 ) type III restriction enzyme, res

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00388250

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD02000 ) Micronucleus: neo3 into SNF2 coding region
  • ( SD02026 ) Micronucleus: neo3 into SNF2 coding region Macronucleus: neo3 into SNF2 coding region
  • ( SD02027 ) Micronucleus: neo3 into SNF2 coding region
  • ( SD02028 ) Micronucleus: neo3 into SNF2 coding region
  • ( SD02186 ) Macronucleus: Two HA tags after ATG of SNF2 coding
  • ( SD02187 ) Macronucleus: Two HA tags after ATG of SNF2 coding
  • ( SD02188 ) Macronucleus: Neo 3 into coding of SNF2 in B2086
  • ( SD02189 ) Macronucleus: Neo 3 into coding of SNF2 in B2086

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_64350
Tetrahymena borealisEI9_04448.19.997093137033517e-262SNF2 family domain-containing
protein (1088 aa)
OxytrichaContig16241.0.g1029.997093137033517e-262SNF2 family N-terminal domain
WormBaseWBGene000021699.998061997456677e-175locus:isw-1 Chromatin-remode
ling complex ATPase chain isw-
1 status:Confirmed UniProt
:P41877 protein_id:CCD70709.
1
DictyBaseDDB_G02929481.9993181170755286e-174isw on chromosome: 6 position
2254360 to 2258387
SGDYOR304W2.998539800509618e-166ISW2 ATP-dependent DNA translo
case involved in chromatin rem
odeling; ATPase component that
, with Itc1p, forms a complex
required for repression of a-s
pecific genes, INO1, and early
meiotic genes during mitotic
growth

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00388250(coding)
ATGACTACAAAGAGTAGAAAATCAAAGACTGAAATGGAGGAAATGAATACTCCAGATTAA
GATGAGTTTGAATAAAAGAAGAAAAAAATAGAAGAAATCCTGCAGAAAGCTTTAGATTAT
ACTTAAAAACTTATTCTACATAGAAAAGAAGCTAGTAAATAGGCAATATAGTAGACAGAT
GATTTTAAGTCAAAAAAGAAAGAATCAAAAAGAAAGCATGACAGAGAATAGCAACAATAA
ATTAACAAAGAAGAAAGAATTATGTAAAGAAAATCAACTGGTAGCGAAAATGATTATACT
TACTTGACAGTTTAGCCTAGTAATATTTAATTTGGTGTATTAAAGAATTATTAAATGAAT
GGTTTGAACTGGCTAATATAGTTATATGAATTGAAAATGAATGGAATTTTAGCTGATGAT
ATGGGTTTAGGAAAGACCATTTAAACAATCTCTATGATAGCCTTTTTAAAGCAATTTAAG
CATATTAATGGTAAGCATTTGATTATTGGACCTCTTGCAACATTAAATAATTGGTTAAAT
GAATTTACTAAATGGCTTCCTTGCTGTAAAGCAACTATTTTATATGCTAGAGAAGAAGAA
AGAAATAAAACTCTTTAGGAATATGTGAAATCTGATAAATTTGAAGTTATTATTACTTCT
TATGAAGGCATCAAAAAATCTGCATCTGACCTTTAGAAAATTTAATGGGAATATATGATT
GTGGATGAAGCACATAAATTAAAAAATGACTAGAGTCAGCTCAGTTTACTTTTACGTAAA
TTTAAAACAAAAAATAGATTGCTGCTCACTGGTACACCTCTCCAAAACGACATTCATGAA
TTAATTAGTTTGCTTAATTTTGTCATGCCATAAATTTTTACTGACTGTGATACATTTGAT
GAATTTTTAACCTCTAAGAAAAAGAAGCAATCAGAGTCTGAGTCTGACAGATAGCAAGAA
AATAATGAGGAACCTAACGAAGAATATAATTAAGAAGACAATCTTAGTGAGATAGATAAA
TAAAAAATGGAATTAGTTAAATAGCTTCATCAAATTATTACACCTTTCATGCTTAGAAGA
ACCAAAGAGGATTCACTTAAAGATTTACCTCCCAAAAAAGAAATACATTTGTATGTTGGT
TTAAGTGATTTACAATTAAAAATGTATAGAAACATTCTTCTAAACAAAACAATAGACAGT
GTATACATAGGAGATTAAAAAAGGAATTATAATAATACACTAATGTAGCTCAGAAAAGTA
TGTATACATCCTTATCTTTTTGATGGTGTTGAAGACAGATCTCTCCCAGAATATGGAGAT
CACCTTGTTTACAATAGTGGTAAAATGGTGGTCTTAGACAAATTGCTTAAAAAATTGTAC
CAAGAGAAAGAAAAAGCTCATCAAGTTTTGATTTTTACTTAATTCACAACTTGTTTAGAT
ATTTTAGAAGATTATTTGATAGGAAAAGCTTGGAATTATTGTCGTATAGATGGTAGTACA
GAAGTTAATGAAAGAGAATAAATGATGAATGAGTTTCAAAGAGATGACTCCGATAAATTT
GTTTTCCTTCTTTCAACTAGAGCAGGTGGATTAGGAATTAATTTGACAAAAGCTAACTTT
GTTGTAATATTTGATAGCGATTTTAACCCATAGATAGATTTGTAAGCAATGGACAGAGCA
TATAGAATTGGTTAAACGAGGGAAGTGAAGGTGATCAGACTAATTACTTAATTTACTGTA
GAAGAAAAAATAATAGAGAGGTAAGGTATTAAATTGAAGTTGGATTAACTTATCATACAA
AGTGGAAGATCTTATTCTACAAATTTCAACTTAGACTAGCATAACATAAAGAATATAACC
TAATTTGGTGCAGATGAAATATTCAAAGCAAAAGGATCAACCATCTCAGATGATGATATT
GATATGATTCTGGCAAAAGGTGAAAAAAAGACTGATGAGTAAAATAAAGAAATATAAAAA
TTAGTTGAAGAAAAAATGAAAGGACTGTTTGATTTAGAAGTTAAAAGTATCAAATGCAAA
GAGCTATTTGGTGAAGATCCTCGTTTATAGGACGAAATAGCTATTAAGCAAGCTGCTCTT
TAATCAGAGCTTGAAGAAAAGAAAAAAATTTACGAAGATTAAATTAAAAAAAATAAATTA
ATTAAAGTTAAGATTATTTAATTACCTGAATACCAGCTTTTTGAGAGTAAATCAAGGTTA
GAGCAACTATTATAAAAAGAGGAAGAGTACTTAGCTAGAGGAGGAATAATGTACAAAGTC
GGTTTGTACAGTGAAGAATTTATATAAAATATGGCAAAAAATAATGGTCTTACTGATGAT
GAATTGAAAGAAAAAGAGTAATTAATGTAATAAGGATTTCCTTATTGGGATGCTAATGAT
TACAAAGAATTTTTGAAAGCTTCTTACTTGTACGGAAGAGGTGATTTCGAAAAAATTGCT
GCATTTATGAATAAACCTTTAGATGAAGTCAGAGATTATCACAGAGCTTTCTGGTAAAGA
GGAGAAAAATGTATCAGTAACTTTAATTATATTTAAAAAAAAGTTGAAACTACTGACAAA
AATATTTAAATGGCTAAGGAGTTTACAGATTTTGTTAAAATGAAGATAGATGACAGTGAG
TATATTTAAGAAAATATTACTTTCGATAGTAAAATATACAAAAAATATTCAAGCTAAAAA
CACTCCTTAGATAAAGATTAATTAATAATATATTCATTTTATAAATATGGATATGGTGAA
TGGGAGAAGATTTTATATGATATATAAAATAACGTTTACTTTAGTCTCGATGAAAACTTT
AGAATGATGAGAGAAAGTGATATTAAGGCAAGAGCAAGATCACTATTCAACATTTTGAAA
GCAGAAAATGATAACTAATTGCTAGGAGTGCGTTAAAGATAAATATAACTCAAAAAGATG
TAAGAAGAAAATAAATAGAATAAAAAAGGAGGAAAAAAAGCATAAAAGTAAGATAGTGAA
TCAAGTAACAATTCAATATTAAGTAGAAATAGTGCAGATAAAGATGGCTTTAACAAAGTA
AAACCAACCAATAAAGAAGCTAAAAAAGATTAGAAACGTCAAAAATTAGTTAGCGAGAAA
CCTCAACAAATTATTGAAGATGATATAGAAAACATAGAAAAAAATGTAATAAAAAAAGAA
AACAAAAATAAAAACAAAAAAAATGCTGTGGAAAAACAAAATGTAAATCAAAAAGACCAA
GAAAACTAATAAAAATAAAAAATATTATAAGATAATCAAAATGAAAATAAATTAGAAAAT
TATTTTAGTAAAATTGATAAAATAGTTAAAAAGTGA


>TTHERM_00388250(protein)
MTTKSRKSKTEMEEMNTPDQDEFEQKKKKIEEILQKALDYTQKLILHRKEASKQAIQQTD
DFKSKKKESKRKHDREQQQQINKEERIMQRKSTGSENDYTYLTVQPSNIQFGVLKNYQMN
GLNWLIQLYELKMNGILADDMGLGKTIQTISMIAFLKQFKHINGKHLIIGPLATLNNWLN
EFTKWLPCCKATILYAREEERNKTLQEYVKSDKFEVIITSYEGIKKSASDLQKIQWEYMI
VDEAHKLKNDQSQLSLLLRKFKTKNRLLLTGTPLQNDIHELISLLNFVMPQIFTDCDTFD
EFLTSKKKKQSESESDRQQENNEEPNEEYNQEDNLSEIDKQKMELVKQLHQIITPFMLRR
TKEDSLKDLPPKKEIHLYVGLSDLQLKMYRNILLNKTIDSVYIGDQKRNYNNTLMQLRKV
CIHPYLFDGVEDRSLPEYGDHLVYNSGKMVVLDKLLKKLYQEKEKAHQVLIFTQFTTCLD
ILEDYLIGKAWNYCRIDGSTEVNEREQMMNEFQRDDSDKFVFLLSTRAGGLGINLTKANF
VVIFDSDFNPQIDLQAMDRAYRIGQTREVKVIRLITQFTVEEKIIERQGIKLKLDQLIIQ
SGRSYSTNFNLDQHNIKNITQFGADEIFKAKGSTISDDDIDMILAKGEKKTDEQNKEIQK
LVEEKMKGLFDLEVKSIKCKELFGEDPRLQDEIAIKQAALQSELEEKKKIYEDQIKKNKL
IKVKIIQLPEYQLFESKSRLEQLLQKEEEYLARGGIMYKVGLYSEEFIQNMAKNNGLTDD
ELKEKEQLMQQGFPYWDANDYKEFLKASYLYGRGDFEKIAAFMNKPLDEVRDYHRAFWQR
GEKCISNFNYIQKKVETTDKNIQMAKEFTDFVKMKIDDSEYIQENITFDSKIYKKYSSQK
HSLDKDQLIIYSFYKYGYGEWEKILYDIQNNVYFSLDENFRMMRESDIKARARSLFNILK
AENDNQLLGVRQRQIQLKKMQEENKQNKKGGKKAQKQDSESSNNSILSRNSADKDGFNKV
KPTNKEAKKDQKRQKLVSEKPQQIIEDDIENIEKNVIKKENKNKNKKNAVEKQNVNQKDQ
ENQQKQKILQDNQNENKLENYFSKIDKIVKK


>TTHERM_00388250(gene)
ATGACTACAAAGAGTAGAAAATCAAAGACTGAAATGGAGGAAATGGTAACATAATTATTT
TTTATCATTTTATATAGGAAATTAATTAAAAGAATACTCCAGATTAAGATGAGTTTGAAT
AAAAGAAGAAAAAAATAGAAGAAATCCTGCAGAAAGCTTTAGATTATACTTAAAAACTTA
TTCTACATAGAAAAGAAGCTAGGTAATTATTATGTTTTGTGTTTCTATCTTTACTTTTAA
AATATTATTTAGTATAATTTTTAAAATACTTTTTTGGATATTAGTAAATAGGCAATATAG
TAGACAGATGATTTTAAGTCAAAAAAGAAAGAATCAAAAAGAAAGCATGACAGAGAATAG
CAACAATAAATTAACAAAGAAGAAAGAATTATGTAAAGAAAATCAACTGGTAGCGAAAAT
GATTATACTTACTTGACAGTTTAGCCTAGTAATATTTAATTTGGTGTATTAAAGAATTAT
TAAATGAATGGTTTGAACTGGCTAATATAGTTATATGAATTGAAAATGAATGGAATTTTA
GCTGATGATATGGGTTTAGGAAAGACCATTTAAACAATCTCTATGATAGCCTTTTTAAAG
CAATTTAAGCATATTAATGGTAAGCATTTGATTATTGGACCTCTTGCAACATTAAATAAT
TGGTTAAATGAATTTACTAAATGGCTTCCTTGCTGTAAAGCAACTATTTTATATGCTAGA
GAAGTAAAATATCTACTGAATTCTACTTTTTTTTAATAATTGATATTTTAATACCTATCA
AAATAAGGAAGAAAGAAATAAAACTCTTTAGGAATATGTGAAATCTGATAAATTTGAAGT
TATTATTACTTCTTATGAAGGCATCAAAAAATCTGCATCTGACCTTTAGAAGTAAGCATT
TTTTAGAAAATAACTTGATAAATATAATTTTATTCGTTCAATTTTAAAACAGAATTTAAT
GGGAATATATGATTGTGGATGAAGCACATAAATTAAAAAATGACTAGAGTCAGCTCAGTT
TACTTTTACGTAAATTTAAAACAAAAAATAGATTGCTGCTCACTGGTACACCTCTCCAAA
ACGACATTCATGAATTAATTAGTTTGCTTAATTTTGTCATGCCATAAATTTTTACTGACT
GTGATACATTTGATGAATTGTAAAATATTTTGTTCAGTAAAACACAATTTAAAAATTTTT
ATCAAGTTTAACCTCTAAGAAAAAGAAGCAATCAGAGTCTGAGTCTGACAGATAGCAAGA
AAATAATGAGGAACCTAACGAAGAATATAATTAAGAAGACAATCTTAGTGAGATAGATAA
ATAAAAAATGGAATTAGTTAAATAGCTTCATCAAATTATTACACCTTTCATGCTTAGAAG
AACCAAAGAGGATTCACTTAAAGATTTACCTCCCAAAAAAGAAATACATTTGTATGTTGG
TTTAAGTGATTTACAATTAAAAATGTATAGAAACATTCTTCTAAACAAGTAAATAATTCA
TTCTTAAAAAATCAAACATAACAAACATAACAGAAAAAATATTTTTTTTAAAATTCAGAT
AATTTTTTTTTAATTTAAATTAAAAAAAATATTTTATTAATAAATTTAGAACAATAGACA
GTGTATACATAGGAGATTAAAAAAGGAATTATAATAATACACTAATGTAGCTCAGAAAAG
TATGTATACATCCTTATCTTTTTGATGGTGTTGAAGACAGATCTCTCCCAGAATATGGAG
ATCACCTTGTTTACAATAGTGGTAAAATGGTGGTCTTAGACAAATTGCTTAAAAAATTGT
ACCAAGAGAAAGAAAAAGCTCATCAAGTTTTGATTTTTACTTAATTCACAACTTGTTTAG
GTAAAATTTTAGTTAAAATGATAAATGACTTATGTTTATAATAATGAAAAAGATATTTTA
GAAGATTATTTGATAGGAAAAGCTTGGAATTATTGTCGTATAGATGGTAGTACAGAAGTT
AATGAAAGAGAATAAATGATGAATGAGTTTCAAAGAGATGACTCCGATAAATTTGTTTTC
CTTCTTTCAACTAGAGCAGGTGGATTAGGAATTAATTTGACAAAAGCTAACTTTGTTGTA
ATATTTGATAGCGATTTTAACCCATAGATAGATTTGTAAGCAATGGACAGAGCATATAGA
ATTGGTTAAACGAGGGAAGTGAAGGTGATCAGACTAATTACTTAATTTACTGTAGAAGAA
AAAATAATAGAGAGGTAAGGTATTAAATTGAAGTTGGATTAACTTATCATACAAAGTGGA
AGATCTTATTCTACAAATTTCAACTTAGACTAGCATAACATAAAGAATATAACCTAATTT
GGTGCAGATGAAATATTCAAAGCAAAAGGATCAACCATCTCAGATGATGGTAACTATTTT
TAATTTATTTCATGAACTTATTTTAAATAATAAATATTAATAATAATATTTTAGATATTG
ATATGATTCTGGCAAAAGGTGAAAAAAAGACTGATGAGTAAAATAAAGAAATATAAAAAT
TAGTTGAAGAAAAAATGAAAGGACTGTTTGATTTAGAAGTTAAAAGTATCAAATGCAAAG
AGCTATTTGGTGAAGATCCTCGTTTATAGGACGAAATAGCTATTAAGCAAGCTGCTCTTT
AATCAGAGCTTGAAGAAAAGAAAAAAATTTACGAAGATTAAATTAAAAAAAATAAATTAA
TTAAAGTTAAGATTATTTAATTACCTGAATACCAGCTTTTTGAGAGTAAATCAAGGTTAG
AGCAACTATTATAAAAAGTAAATTTTATATTATTTTAGTTTGTTAGTAAATTAATTTGTT
AACAAATTTAGGAGGAAGAGTACTTAGCTAGAGGAGGAATAATGTACAAAGTCGGTTTGT
ACAGTGAAGAATTTATATAAAATATGGCAAAAAATAATGGTCTTACTGATGATGAATTGA
AAGAAAAAGAGTAATTAATGTAATAAGGATTTCCTTATTGGGATGCTAATGATTACAAAG
AATTTTTGAAAGCTTCTTACTTGTACGGAAGAGGTGATTTCGAAAAAATTGCTGCATTTA
TGAATAAACCTTTAGATGAAGTCAGAGATTATCACAGAGCTTTCTGGTAAAGAGGAGAAA
AATGTATCAGTAACTTTAATTATATTTAAAAAAAAGTTGAAACTACTGACAAAAATATTT
AAATGGCTAAGGAGTTTACAGATTTTGTAAATTAAAAATTATTGTGAATGAAAATTAAAT
TCTTATTTTTAAAATAAAGGTTAAAATGAAGATAGATGACAGTGAGTATATTTAAGAAAA
TATTACTTTCGATAGTAAAATATACAAAAAATATTCAAGCTAAAAACACTCCTTAGATAA
AGATTAATTAATAATATATTCATTTTATAAATATGGATATGGTGAATGGGAGAAGATTTT
ATATGATATATAAAATAACGTTTACTTTAGTCTCGATGAAAACTTTAGGTAAGGAATATT
CAATTTATTTAAATAATTATTAACCAATTGCTTCAATGGAATCATTAAAATTAATTTATT
TAAATTAAACTGAACAGAATGATGAGAGAAAGTGATATTAAGGCAAGAGCAAGATCACTA
TTCAACATTTTGAAAGCAGAAAATGATAACTAATTGCTAGGAGTGCGTTAAAGATAAATA
TAACTCAAAAAGATGTAAGAAGAAAATAAATAGAATAAAAAAGGAGGAAAAAAAGCATAA
AAGTAAGATAGTGAATCAAGTAACAATTCAATATTAAGTAGAAATAGTGCAGATAAAGAT
GGCTTTAACAAAGTAAAACCAACCAATAAAGAAGCTAAAAAAGATTAGAAACGTCAAAAA
TTAGTTAGCGAGAAACCTCAACAAATTATTGAAGATGATATAGAAAACATAGAAAAAAAT
GTAATAAAAAAAGAAAACAAAAATAAAAACAAAAAAAATGCTGTGGAAAAACAAAATGTA
AATCAAAAAGACCAAGAAAACTAATAAAAATAAAAAATATTATAAGATAATCAAAATGAA
AATAAATTAGAAAATTATTTTAGTAAAATTGATAAAATAGTTAAAAAGTGA