Identifiers and Description

Gene Model Identifier

TTHERM_00925560

Standard Name

SNF12

Aliases

PreTt04363 | 165.m00081 | 3747.m00334

Description

Member of the SWI/SNF complex.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00925560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20685.19.997093137033517e-262SWIB/MDM2 domain-containing pr
otein (558 aa)
WormBaseWBGene000440726.99697739292434e-35locus:ham-3 status:Confirmed
UniProt:Q09646 protein_id
:CAA87424.1
DictyBaseDDB_G02737251.9991517704232713e-32snf12-2 on chromosome: 2 posit
ion 3329319 to 3330893
OxytrichaContig940.0.g88.000721090200152e-18SWIB/MDM2 domain
Stentor CoeruleusSteCoe_287650.00000000003775134544279098
SGDYOR295W0.000019995566179747357UAF30 Subunit of UAF (upstream
activation factor), which is
an RNA polymerase I specific t
ranscription stimulatory facto
r composed of Uaf30p, Rrn5p, R
rn9p, Rrn10p, histones H3 and
H4; deletion decreases cellula
r growth rate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29523178: Saettone A, Garg J, Lambert JP, Nabeel-Shah S, Ponce M, Burtch A, Thuppu Mudalige C, Gingras AC, Pearlman RE, Fillingham J (2018) The bromodomain-containing protein Ibd1 links multiple chromatin-related protein complexes to highly expressed genes in Tetrahymena thermophila. Epigenetics & chromatin 11(1):10

Sequences

>TTHERM_00925560(coding)
ATGTAAAATTAATAGGTAAATCCAGCAGCTGGCATGAGTGCTCCTTAAAACCCAAATATG
ATGAATGGCTAGTAACGCCCCTTGGGACCTCCCTAGCCCTAAGGACACTTTTAAAGAAAT
TAGATGGCTAATCCTCAAGGACAAGGAGGAATGGGAGGAAATTAATAAGGTGTAATTTAT
GGATAAGGTGGATAATAAGGCCACCCACAATAGCAAATTATGAGTTAATAATAAGGAGTT
TAGCCAAATCAATAATAAAATATTCCATAGTAATAACAGCAGCAATAAGGTTCATAATCG
CACGCAGCATAAGAAAGTTATATTGACCCAAAATAGCTGATTCATTCGATTTATGAAAAG
GGTAATATTGGGTATTCTGAGTGTGATGAAGAATTATTAAAAATAGCCCCAGAATTTGAA
TTACTTAATTAGCTTGTTAAATATGAAGGAATGATTGATAAAATGGTGAAAAGAAAGAGA
TTCGATTTACAGGAATAGTTTGCAAGACCAAATTAAAAGACAAAACAAATATTCAGAATG
TACATTACTAATGACTATACTTTAGTACCTTAGGGACCTCATATAGATAATGATCCCATG
CAAATTGAATAAGAAGAACAATATATATGGAATCTTAAAATATATGGACATTTGCTTTAA
GAAGACAAGACTAACGCATCATATTTGACAACTCCTAAGCAATATTTTTCAAATTTCTTC
TCAAAAATCACTGTAGAATTCAAGGATCCTCTTTTCAGCAGCGAACCCGTTTAATGGAGA
AAGTCAGATAAGGTAGAGTAGGGAATAATCATTCGCAAATAAAGCAGCAAGGAAACAGTA
GTTACAATTCATATTCATTTGTATCACAACCCTTTGAAGTTTAGAGTTGATCCTAAGCTC
GCTTCAATTATTGGGTTTGAAATTTGCACTAGATCAACTGCTTTGGCTGCTATTTGGGAA
TATATTAAGCTTAAAAATTTGTAAGACAGTGAAAATAAAAGTGAGATAAATTGTGATGAT
GCGATGAGAAGCGTATTCTTACAAGACAAAATAAACATAGGACAAATCACAGCAAAATTG
AGATAACTCTTAACTATTCCAAATTAAACAACAATAAGACACCAAATTAAACTTAGCGGC
ACTCCTGAAGAAAACGAAAGAGTTTATGATTTTGTGGTAGACGTAGATAGTTAATTGGGT
ATGGAAATTATGCCTTTCTTCTCTCAAAAGGTCGTTTTATAGGAAAAGAAAGATTCACAA
AAGCATCCCTTCATTACCTTAAACTAAAAGATTAAAGATTTAGATAAAAAATTTACAGAA
ACATTAGAAAAAATAAAATCACATAAGTTCAAAAGAGATTCGTATTTCGCCTACACCTTA
GATCCATCTCTTTATATAGAAAATACTATCTTACAATAAAATATATACTTATAGATGATG
AAAGAAGATAAATAATGTCCTATCGATGATCCTACTTCCTTGCAATACATGATGGATAAC
GAAGATTTGGTTGAAAGAGAGATTAAAAGATATCTCGATAATTTGGATGGAATTAAGGGA
GAAAGAGAATTTGAACTTTATTAATAAGAAATGCTTAACAACTAGAATACATATGATGCA
ACAAGCAATGCAAACCAATCATAATAACAGCTTTGA


>TTHERM_00925560(protein)
MQNQQVNPAAGMSAPQNPNMMNGQQRPLGPPQPQGHFQRNQMANPQGQGGMGGNQQGVIY
GQGGQQGHPQQQIMSQQQGVQPNQQQNIPQQQQQQQGSQSHAAQESYIDPKQLIHSIYEK
GNIGYSECDEELLKIAPEFELLNQLVKYEGMIDKMVKRKRFDLQEQFARPNQKTKQIFRM
YITNDYTLVPQGPHIDNDPMQIEQEEQYIWNLKIYGHLLQEDKTNASYLTTPKQYFSNFF
SKITVEFKDPLFSSEPVQWRKSDKVEQGIIIRKQSSKETVVTIHIHLYHNPLKFRVDPKL
ASIIGFEICTRSTALAAIWEYIKLKNLQDSENKSEINCDDAMRSVFLQDKINIGQITAKL
RQLLTIPNQTTIRHQIKLSGTPEENERVYDFVVDVDSQLGMEIMPFFSQKVVLQEKKDSQ
KHPFITLNQKIKDLDKKFTETLEKIKSHKFKRDSYFAYTLDPSLYIENTILQQNIYLQMM
KEDKQCPIDDPTSLQYMMDNEDLVEREIKRYLDNLDGIKGEREFELYQQEMLNNQNTYDA
TSNANQSQQQL


>TTHERM_00925560(gene)
ATGTAAAATTAATAGGTAAATCCAGCAGCTGGCATGAGTGCTCCTTAAAACCCAAATATG
ATGAATGGCTAGTAACGCCCCTTGGGACCTCCCTAGCCCTAAGGACACTTTTAAAGAAAT
TAGATGGCTAATCCTCAAGGACAAGGAGGAATGGGAGGAAATTAATAAGGTGTAATTTAT
GGATAAGGTGGATAATAAGGCCACCCACAATAGCAAATTATGAGTTAATAATAAGGAGTT
TAGCCAAATCAATAATAAAATATTCCATAGTAATAACAGCAGCAATAAGGTTCATAATCG
CACGCAGCATAAGAAAGTTATATTGACCCAAAATAGCTGATTCATTCGATTTATGAAAAG
GGTAATATTGGGTATTCTGAGTGTGATGAAGAATTATTAAAAATAGCCCCAGAATTTGAA
TTACTTAATTAGCTTGTTAAATATGAAGGAATGATTGATAAAATGGTGAAAAGAAAGAGA
TTCGATTTACAGGAATAGTTTGCAAGACCAAATTAAAAGACAAAACAAATATTCAGAATG
TACATTACTAATGACTATACTTTAGTACCTTAGGGACCTCATATAGATAATGATCCCATG
CAAATTGAATAAGAAGAACAATATATATGGAATCTTAAAATATATGGACATTTGCTTTAA
GAAGACAAGGTAAAATTTATAGCAATAATTGGGATTGAATAGGTTTTCTAATGATTCTTT
TTATAACAGACTAACGCATCATATTTGACAACTCCTAAGCAATATTTTTCAAATTTCTTC
TCAAAAATCACTGTAGAATTCAAGGATCCTCTTTTCAGCAGCGAACCCGTTTAAGTAAAA
ATAAATTGAAGAAATGTTAATAAAGTATTAAGTATAATATTTGATGTAGTGGAGAAAGTC
AGATAAGGTAGAGTAGGGAATAATCATTCGCAAATAAAGCAGCAAGGAAACAGTAGTTAC
AATTCATATTCATTTGTATCACAACCCTTTGAAGTTTAGAGTAAATTTAAATAAATAAGG
AATAATAATTTTAAACAATATTTAAATGAATTGGTTAATAGGTTGATCCTAAGCTCGCTT
CAATTATTGGGTTTGAAATTTGCACTAGATCAACTGCTTTGGCTGCTATTTGGGAATATA
TTAAGGTAACTTAACGAAAATAATTAGAACTTTCAATTAATTATTTAATTATCTGCCAAA
TAATTTTCAATTCACTCTCTTTAAAATAGAGCGCGCAATTTGATGAATTATTTAAATATT
TAATCTACTATTTACTTATAACAAAAGCTTAAAAATTTGTAAGACAGTGAAAATAAAAGT
GAGATAAATTGTGATGATGCGATGAGAAGCGTAAAATTGCGATTATGGAATGCAAATTGA
ATGTTTAATTATAAAATTAACTTTAAAATAGGTATTCTTACAAGACAAAATAAACATAGG
ACAAATCACAGCAAAATTGAGATAACTCTTAACTATTCCAAATTAAACAACAATAAGACA
CCAAATTAAGTAACTATTTTAATGAAAATAAATGATTCTTATGATTGTAATTTAATTAGA
CTTAGCGGCACTCCTGAAGAAAACGAAAGAGTTTATGATTTTGTGGTAGACGTAGATAGT
TAATTGGGTATGGAAATTATGCCTTTCTTCTCTCAAAAGGTCGTTTTATAGGAAAAGAAA
GATTCACAAAAGCATCCCTTCATTACCTTAAACTAAAAGATTAAAGATTTAGATAAAAAA
TTTACAGAAACATTAGAAAAAATAAAATCACATAAGTTCAAAAGAGATTCGTATTTCGCC
TACACCTTAGATCCATCTCTTTATATAGAAAATACTATCTTACAATAAAATATATACTTA
TAGGTAATTATTAAATTCTAATAAGAATCATTATTTTAATATATCTATTTCATTTAAAAG
ATGATGAAAGAAGATAAATAATGTCCTATCGATGATCCTACTTCCTTGCAATACATGATG
GATAACGAAGTAAAACACAAATTTTAATTTAAGCAATAAAATAAATTCAATAATTATTTT
CATTTTAGGATTTGGTTGAAAGAGAGATTAAAAGATATCTCGATAATTTGGATGGAATTA
AGGGAGAAAGAGAATTTGAACTTTATTAATAAGAAATGCTTAACAACTAGAATACATATG
ATGCAACAAGCAATGCAAACCAATCATAATAACAGCTTTGA