Identifiers and Description

Gene Model Identifier

TTHERM_00410130

Standard Name

SMT3 (Suppressor of Mif Two )

Aliases

PreTt21530 | 44.m00197 | 3714.m00044 | SUMO

Description

small ubiquitin-related modifier (SUMO), conjugated to lysine residues on target proteins, post-translational modification,

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00410130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
OxytrichaContig18025.0.g129.995528898049344e-31Ubiquitin-2 like Rad60 SUMO-li
ke
DictyBaseDDB_G02861895.00179831534194e-27sumo on chromosome: 4 position
4217038 to 4217552
SGDYDR510W9.995317835403734e-19SMT3 Ubiquitin-like protein of
the SUMO family, conjugated t
o lysine residues of target pr
oteins; regulates chromatid co
hesion, chromosome segregation
, APC-mediated proteolysis, DN
A replication and septin ring
dynamics; phosphorylated at Se
r2
WormBaseWBGene000048884.0009493637353324e-18locus:smo-1 Small ubiquitin-
related modifier status:Conf
irmed UniProt:P55853 prote
in_id:CCD72942.1
Stentor CoeruleusSteCoe_193430.000000000000004658886145103398

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25527524: Nasir AM, Yang Q, Chalker DL, Forney JD (2015) SUMOylation is developmentally regulated and required for cell pairing during conjugation in Tetrahymena thermophila. Eukaryotic cell 14(2):170-81
  2. Ref:26453653: Yang Q, Nasir AM, Coyne RS, Forney JD (2015) Depletion of UBC9 Causes Nuclear Defects during the Vegetative and Sexual Life Cycles in Tetrahymena thermophila. Eukaryotic cell 14(12):1240-52
  3. Ref:16682458: Matsuda A, Forney JD (2006) The SUMO pathway is developmentally regulated and required for programmed DNA elimination in Paramecium tetraurelia. Eukaryotic cell 5(5):806-15

Sequences

>TTHERM_00410130(coding)
ATGACTGATTAAAACGCTAACGCTAACAGTGAATATCTTAATCTTAAAGTTAAATCTTAG
GAAGGAGAAGAAATTTTCTTTAAAATTAAAAAAACTACTCAATTTAAGAAACTTATGGAT
GCTTACTGTCAAAGAGCTTAAGTTAACGCCCATAATGTAAGATTCCTCTTCGATGGTGAT
AGAATCCTTGAATCTCACACCCCCGCTGATCTTAAAATGGAAAGTGGAGATGAAATCGAC
GTTGTTGTTGAACAAGTTGGTGGCTCTTTCTGA


>TTHERM_00410130(protein)
MTDQNANANSEYLNLKVKSQEGEEIFFKIKKTTQFKKLMDAYCQRAQVNAHNVRFLFDGD
RILESHTPADLKMESGDEIDVVVEQVGGSF


>TTHERM_00410130(gene)
ATGACTGATTAAAACGCTAACGCTAACAGTGAATATCTTAATCTTAAAGTTAAATCTTAG
GTAAAATATAAAATACTTATTTAAACTAGAGCCAACCGTCTTTAGCAAAACAGTTGAAGC
ATAGATTATTTACTTATATATCAATTTCTCTAAAGCAATCCTCTACTTGGAATAGCCAAT
AAATATTTGCTTAATATTCAATCTATGTAGCAAAGCCCCACAAAAATAAATTAAAATATT
TTACGAAATTTAATCTATCGATATATACGAATTTACGAAATGAAATTAACTCATTAGTAG
ACTTCAATTTATAAATCAGCTTCATAATTATTTTAAAAGCGGCTCAGTTCATTCTAAAAT
ATCTTTTATAAAATTATTCTAATAATAATAATAATAATAATAGGAAGGAGAAGAAATTTT
CTTTAAAATTAAAAAAACTACTCAATTTAAGAAACTTATGGATGCTTACTGTCAAAGAGC
TTAAGTAAAAATCTTTTTTGATAGTTTTTAATGCTAGAAATATAAATAAAATAAAATATT
ACAGAAATTTTGAAATATCATTTAAATTTGCTAATTTGTTATTATTAATTCAATTAAAGG
TTAACGCCCATAATGTAAGATTCCTCTTCGATGGTGATAGAATCCTTGAATCTCACACCC
CCGCTGATGTAATTTTTAATTTAAAAATTTAAAAATCGTGAACAACTTCAAATAAAAGCC
ATTCTTATTACAAATTTATAATATTCAATAAATAAGACTATGAAAAAATTAATTATCCTA
CTTTGAAATTTGTTTGTTTGTTTACTGTTTTTAAGCAATAAAATTTATTCAAAAGTTATG
TTAATATCTTACTTATTTAAATAAAAAATAGCTTAAAATGGAAAGTGGAGATGAAATCGA
CGTTGTTGTTGAACAAGTTGGTGGCTCTTTCTGA