Identifiers and Description

Gene Model Identifier

TTHERM_00548030

Standard Name

SMPD1 (SphingoMyelinase PhophoDiesterase 1)

Aliases

PreTt15052 | 71.m00179 | 3729.m00056

Description

Endonuclease/Exonuclease/phosphatase family protein; cleaves sphingomyelin into cermaide and phosphocholine, second messengers for apoptosis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

  • ( TIGR03395 ) sphingomyelin phosphodiesterase
  • ( PF03372 ) endonuclease/exonuclease/phosphatase family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00548030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17053.19.997093137033517e-262endonuclease/Exonuclease/phosp
hatase (498 aa)
OxytrichaContig19618.0.g44.000010081770683e-74Endonuclease/Exonuclease/phosp
hatase family
DictyBaseDDB_G02880171.999534248571833e-46DDB_G0288017 on chromosome: 5
position 978356 to 979732
Stentor CoeruleusSteCoe_27061.4251640827409352e-21
WormBaseWBGene000121050.000019995566179747357Putative neutral sphingomyelin
ase status:Confirmed UniPr
ot:O45870 protein_id:CAB0488
5.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00548030(coding)
ATGAAGACATAAGATTTTAAATCCAACCAAAAATCTGGCGATATTGAATCACAAATGCCT
AAATAAGGTTAGAAGGAACAAAGATCAAATAAGGAAAATTCACCTGAAAGATCGTAGCAA
AATATTTCAACGAGCTCAAACAATATTGATAAAATAAACAATACTTTAAATAGCTCGAAT
TTTGAAATTGGAGACAGATTGCCAATGCAAAAAATCTAAGTTATAAAATAAAATTCATCA
CCAAAGAACAACGTTATCTCTAATTATTTAAGCTAAGGAATTAGGTCTGTTCGTGTTCTC
ACTTATAACATCTTTCTAAGACCTCCACCAATCAAGAACAATAAAGACGACTACAAAAAT
GAGAGAACTAAGCTTTTTCTCAATTCAATAAGTGACTTTGATATTGTTTGTCTTTAGGAA
TTGTTTGGTTTTCTCAACCAACGCAAACACAAAATTATATTCAATGCTATGAAACAAGGA
TTCTTCTATCATGCAACATCACCTTCTCCTTCCTTTTTTAGCTCCTACTTGGTAGATGGA
GGATTAGTAACAATTTCTAGATTTCCCATCATAGAAAAGTCGTACAGACCTTTTAAATAT
GGAGTCCTCTCAGATAATTTATCATAGAAGGGTGTTCTATACACAAAAATTTAAGCAAAC
GATTCGTATATTCATCTTTTTAACACACATCTTCAAGCTAGTTACGTAGGTGCTGAAAAT
AATGTGAAAGCTACAGTTATCACAAGAGTAGACCAACTTATTTTGATAAAAGACTTCATA
AAAGAATAAGTAAAAAAGCACAGAGAAAAGGAGAGTGATATTATTATGATTTGTGGTGAT
TTCAATGTTAATGCTCGTCCCTAAACTTATCCTATTCATTATTTAAATGATGTTCCTGAT
ATTTAAGAATATATCAGAAAAATAAACCCAAAAGAATTTAGTGAGTATGACATCCTTAGA
TACATTCTATCTGACTTTGAAAGTATAGAATTCATAGATACATTAAGGAGAAAATTTAAA
GGTGAGTCTCCCATTACTTATGCCGATACTTACATTGATAGGGAAACTTAATAAGAACTA
CCAATGGAAGAGGCTCTAACAATAAAAGAGGATTTACTCCAAAAATCATGCTTAGACTAT
ATTATTCAATTGAAAATTCCGATTGAAGCAAAAGAAGTATAAGAAAATAACAACAACAAC
AACAATAACAACGAAAATGAAGAAGATGATATTGAAGAATTCAAAATGAAAAAATCAAAT
GCGCAATCTCAAAGTGGATTTGTTTTTGATTACGAATAAGTTTTCTTAGAAAAATTCTTT
GTAAAAAACTAACCATTTACATAGTTAAGCGATCATTATGGTGTTTACACAACCCTGAGA
TACGTAAATGTAAACTAAAAAAGTAGTTTCCAATTTAAAGAGTCTGTTATATCTTCTTAG
GATAAAAAAAATATAGATAATAAAAATTAGCACAGCTTTAACAATGCAAGTTTGAATGAA
TGA


>TTHERM_00548030(protein)
MKTQDFKSNQKSGDIESQMPKQGQKEQRSNKENSPERSQQNISTSSNNIDKINNTLNSSN
FEIGDRLPMQKIQVIKQNSSPKNNVISNYLSQGIRSVRVLTYNIFLRPPPIKNNKDDYKN
ERTKLFLNSISDFDIVCLQELFGFLNQRKHKIIFNAMKQGFFYHATSPSPSFFSSYLVDG
GLVTISRFPIIEKSYRPFKYGVLSDNLSQKGVLYTKIQANDSYIHLFNTHLQASYVGAEN
NVKATVITRVDQLILIKDFIKEQVKKHREKESDIIMICGDFNVNARPQTYPIHYLNDVPD
IQEYIRKINPKEFSEYDILRYILSDFESIEFIDTLRRKFKGESPITYADTYIDRETQQEL
PMEEALTIKEDLLQKSCLDYIIQLKIPIEAKEVQENNNNNNNNNENEEDDIEEFKMKKSN
AQSQSGFVFDYEQVFLEKFFVKNQPFTQLSDHYGVYTTLRYVNVNQKSSFQFKESVISSQ
DKKNIDNKNQHSFNNASLNE


>TTHERM_00548030(gene)
ATGAAGACATAAGATTTTAAATCCAACCAAAAATCTGGCGATATTGAATCACAAATGCCT
AAATAAGGTTAGAAGGAACAAAGATCAAATAAGGAAAATTCACCTGAAAGATCGTAGCAA
AATATTTGTAAATCCATATTATATTTTTCACTGAAATGACATAGTAAATTTGAGATAACA
TTATTTTTAATCCTTTTTTATTGAAAAAACAAAAAGCAACGAGCTCAAACAATATTGATA
AAATAAACAATACTTTAAATAGCTCGAATTTTGAAATTGGAGACAGATTGCCAATGCAAA
AAATCTAAGTTATAAAATAAAATTCATCACCAAAGAACAACGTTATCTCTAATTATTTAA
GCTAAGGAATTAGGTCTGTTCGTGTTCTCACTTATAACATCTTTCTAAGACCTCCACCAA
TCAAGAACAATAAAGACGACTACAAAAATGAGAGAACTAAGCTTTTTCTCAATTCAATAA
GTGACTTTGATATTGTTTGTCTTTAGGAATTGTTTGGTTTTCTCAACCAACGCAAACACA
AAATTATATTCAATGCTATGAAACAAGGATTCTTCTATCATGCAACATCACCTTCTCCTT
CCTTTTTTAGCTCCTACTTGGTAGATGGAGGATTAGTAACAATTTCTAGATTTCCCATCA
TAGAAAAGTCGTACAGACCTTTTAAATATGGAGTCCTCTCAGATAATTTATCATAGAAGG
GTGTTCTATACACAAAAATTTAAGCAAACGATTCGTATATTCATCTTTTTAACACACATC
TTCAAGCTAGTTACGTAGGTGCTGAAAATAATGTGGTAAGAGACTATATTAAACAATATT
TATACTAACTAATTAATTAAAAGCATACTATAAAATTAATTAATTTTCATTCATATTACA
CTAAAATTGATAAACAAAATATATTTAAGCATCATTTTTCTTTTCCAAAATTATTAGAAA
GCTACAGTTATCACAAGAGTAGACCAACTTATTTTGATAAAAGACTTCATAAAAGAATAA
GTAAAAAAGCACAGAGAAAAGGAGAGTGATATTATTATGATTTGTGGTGATTTCAATGTT
AATGCTCGTCCCTAAACTTATCCTATTCATTATTTAAATGATGTTCCTGATATTTAAGTA
ACAAAATTATAATAAACCTTTCTTACTAGAAACATTACAATGTTTAACCTAAAAATAAAA
GGAATATATCAGAAAAATAAACCCAAAAGAATTTAGTGAGTATGACATCCTTAGATACAT
TCTATCTGACTTTGAAAGTATAGAATTCATAGATACATTAAGGGTAATTCAAAAAATTTA
TTTTCAATTAATCAATTTAATTTGATTTCGATTTAAAAATTTTTTTTTTTAAACTAATTT
TTGATTATATGTAAATTATCAAATAGAGAAAATTTAAAGGTGAGTCTCCCATTACTTATG
CCGATACTTACATTGATAGGGAAACTTAATAAGAACTACCAATGGAAGAGGCTCTAACAA
TAAAAGAGGATTTACTCCAAAAATCATGCTTAGACTATATTATTCAATTGAAAATTCCGA
TTGAAGCAAAAGAAGTATAAGAAAATAACAACAACAACAACAATAACAACGAAAATGAAG
AAGTAAGATAATAAATAATACATTTGCTACTAAATTATAATTATTAGAATGCGACAGTTT
CTTGAATTTTATTTTTATCAAATTAAAATAGGATGATATTGAAGAATTCAAAATGAAAAA
ATCAAATGCGCAATCTCAAAGTGGATTTGTTTTTGATTACGAATAAGTTTTCTTAGAAAA
ATTCTTTGTAAAAAACTAACCATTTACATAGTTAAGCGATCATTATGGTGTTTACACAAC
CCTGAGATACGTAAATGTAAACTAAAAAAGTAGTTTCCAATTTAAAGAGTCTGTTATATC
TTCTTAGGATAAAAAAAATATAGATAATAAAAATTAGCACAGCTTTAACAATGCAAGTTT
GAATGAATGA