Identifiers and Description

Gene Model Identifier

TTHERM_00446400

Standard Name

SMC4 (Structural Maintenance of Chromosomes )

Aliases

PreTt03907 | 51.m00273 | 3704.m00129

Description

SMC4 structural maintenance of chromosomes protein; Condensin subunit

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01576 ) Myosin tail
  • ( PF06519 ) TolA protein
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( TIGR00634 ) DNA repair protein RecN
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( PF06470 ) SMC proteins Flexible Hinge Domain
  • ( TIGR02890 ) sporulation protein, yteA family
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( TIGR01635 ) phage virion morphogenesis protein
  • ( TIGR02168 ) chromosome segregation protein SMC
  • ( TIGR02169 ) chromosome segregation protein SMC
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255
  • ( TIGR00157 ) ribosome small subunit-dependent GTPase A
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00446400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_101640
Tetrahymena borealisEI9_10809.19.997093137033517e-262SMC family domain-containing p
rotein (1358 aa)
SGDYLR086W9.997093137033517e-262SMC4 Subunit of the condensin
complex; reorganizes chromosom
es during cell division; forms
a complex with Smc2p that has
ATP-hydrolyzing and DNA-bindi
ng activity; required for tRNA
gene clustering at the nucleo
lus; potential Cdc28p substrat
e
DictyBaseDDB_G02864038.997196413234262e-140smc4 on chromosome: 4 position
4414331 to 4418910
OxytrichaContig19312.0.g1121.0001366335892501e-125RecF/RecN/SMC N terminal domai
n
WormBaseWBGene000048749.999565105288807e-71locus:smc-4 Structural maint
enance of chromosomes protein
4 status:Partially_confirmed
UniProt:Q20060 protein_id
:CAA86336.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:29237819: Howard-Till R, Loidl J (2018) Condensins promote chromosome individualization and segregation during mitosis, meiosis, and amitosis in Tetrahymena thermophila. Molecular biology of the cell 29(4):466-478
  2. Ref:16738332: Cervantes MD, Coyne RS, Xi X, Yao MC (2006) The condensin complex is essential for amitotic segregation of bulk chromosomes, but not nucleoli, in the ciliate Tetrahymena thermophila. Molecular and cellular biology 26(12):4690-700

Sequences

>TTHERM_00446400(coding)
ATGAATTAAGAATCAACTTCAAAAGTATAAGCATAAATGGAAGAAGAAATACCCACTGCT
AAATCAGTTGTTAAACATACTTAAAGTCTGCTCAAAAATTCGGTTCTGAGATAAAATTTA
GCTGGTAAGAGCGAGCAAAGACTTATTGTAAAGTAAATCGTGCTTGAAAACTTTAAGAGT
TATTAAGGTAGATAAGTTATTGGTCCTTTCCATAAAAGATTTACTTCCGTTGTTGGGCCT
AATGGTAGTGGTAAATCAAACTTGATTGAGTCTCTTCTTTTCGTATTTGGTAAAAAAGCT
TCCTGGATGCGTCTCAAAAAACTTGAATAACTCATTCATAACTCTTCAAAGCATTAAAAT
GTTAAAAAAGCTTCTGTCGAAGTTACTTTCCATGAAATTAGAGATAAAGAAGGCGAAGAA
TATGAAGTTATTCCTGGAACTGAATTCACTGTTAGAAGAACAGTTAATAAATCTAGTGTT
TCAAAATACGAGATCAACGATAAAGAAGTATCTCATGTAGAAGTTACTGATACTCTTAAA
TAGAAGGGTATTGATCTTACTAATAACCGTTTCTTAATTCTTTAAGGTGAAGTAGAGTAA
ATTTCACTTATGAAGCCTCGTTCTGGAGATCCAGAAAAACCTGGTTTGCTTGAATATTTG
GAAGATATTATAGGTTCTAATTAATTCAAAGAAGATATTGAAAAGAAAGACGAAGAATAT
GAAGTCCTCTAGAATGAAAGAAGAGAAAAGGGAGAAAGAATGAGAATACACGAAGCTGAT
TTAGAAAAGCTATAAGAATCTAAGAATTTAGCCATCGAATACATTCGTAATGAAAAACTA
AGCTATTAAATGACAAATATTATTGGATAGATCGATCTTTTAAGAAGTAAAAAAGATATA
GAAAAGTTTGAAACAAAGATCAAATAAAATGAGCAATAAAATGTTGAAATGAGAGAAAAA
TTCAAATAGTAATTAAAGGAAAACGAACAAGTTATCAAAGAATATAAGCAAAGCAAAGCT
GAAATAGAAAAAAAGGATTATGAAGTGTAAAAGTATAAAGGTCAATTAAAAAAATTGAAT
GAACGTGATGAATTAATTAGACAAAAGTTAGTATTAGAAACTGAAAACTAAACTAAAGCT
GAGAAATAACTTGAAGATCTTCAAGATGAATATAAAAAAGCTATTCGTGATTAAAAAGAA
TATCAATCTGAATTGCCAGAAAAGTAAGATAGATTAAGAAAATTATTGACTAAAAAAGAT
GACGAAGATGAAAAGCTTAGAGAATTAAAAAGCAAAGTTAACAACGAAAACCAAAAGTTA
GTTAAGGAAAAAAAAGAAATGGAAAAAAAATTATAACCAATTAAGGAGAAAAAACTTGAA
GTTTAATCGAAGAGAGACACACTTTAAAACAGGTTTACTTTGATTTCTCAAGATGCCACA
GCTATTTAAAATGAATATGAAAAGAATTAAAATGAATTAGAAAAAGCTAAATAATTAATA
GAAGATTAGCATACATTGATTAAATAAATTGCTTAAGCTATTTAAGCCATTGAAGCAGGA
TATGAAAAATAAGAAGCTGATAATAAGGAATGTAGGATTATTGAAGAAAAAATTATTAAA
GCCATTTCTGAATGCAAACAAAAAATTGATTAAACAAAATAATCTAATTAAGACTCTCAA
ACAAGAAATAAGGTTTTAAACGAATTAATGATAGCTTAACAATAAGGAAAGCTTAGAGGT
ATTTGTGGAAGATTGGGTGATTTAGCAGCTATCAATGAAGAATATGATGTTGCCATAACT
ACAGCATGTGGTCAATTAGACAATATTATTGTAGATAGATATGATGATGCTTAGAATGCA
GTCAATTACTTGAGAAAGGAAAAAATTGGTAAAGCTTAATTTATTGCTTTAGATAAAATA
GAACATAATAGATAATATATGGAAAAATAATTCTAATGTCCTAGAGGATCATAGAGATTA
TTTGATTTAATTTAATTCAAAGATTAGAAATATAAAGTTGCTTTTTACTTTGCTTTGAGA
AATACTTTGGTTTGTGATAACATTGATCTTGCTACAGAAATAGCTTATGGTCAATAAAGA
CATAGAGTAGTCACTAAAAAAGGAGAATTAATTGATGATTCTGGTGTTATGTCTGGTGGT
GGTGCTGCTAGAAGAGGTGGTATGGCCTCTCAATTAAAAGTGGAGATTTCTCCTGAGGAG
GTTGAAAGATATCAAGCAGAATATAGCAGAAACTAATAAGACTTAGAATAAATTAGAGAA
ACAATTTAGAATACAAATAAGTAACTAAACACATTTATTTAGGAAAAGATGTACTTGGTA
AAGTAGCTCGAAGCTAAGAAGTTTGATTAATAATTGTAGGAAGATAATGTAACCAGATGC
CAAAATAGACTAAAAGCTCTTTAAAAGTAAATGGACGAATAAGAATAGAATGCAAAAGAA
AGATAAGTCATCAAGTAGGAACTTGAAAAATTTGAAAGTGAATATCATGAATATGATGGA
TAAATCATGGAATTAAATAAAAAAATAACCGATATTGATGAGAAAATTAACAAATCAGGT
GGCTAAGAACTTAAGCAATAACAAGAAATTTGCAAGAATATTTAAAATTAAACCTTAGAG
TTGCAAGCAGACGTCAACAAAAAAACTGCTAAATTAAAAGACTTAGAAAAAACTTTAAAG
AACAACGAAAGAGAAAAGAATGAGACATAGGAGAGAATCAAAAAAATAAAAGCTAGTATT
GATCCATTAAAAGATTAGTAATAAAAACTTGAAGAAGATGCTGTTAAGGTATTCAAAGAT
TAACAATAAGCTGAATAGCAGTTAGCAATGTTACAAGAGTAGCAAAAGCAAAGAGATGAA
TAAAAGGCTGGAATTGAAAAAATTATTAAAGATATGAAGGATGCTTTAGAGAAATTAAAA
AAAGAAAAAGATGACTTTGAAGCTAAAATTAACAAAGCAAAAGAAGATTAGAACAGAAGT
GAACATGTTATTGCCAATAACAGAAATACTTACAAAGAAATTACTAAATCATATGATTTC
TTACAATTCATTGATGAAATTGCTGGCTATTAAATTAATGAGAGTGAGGATAAGAAATCT
GATGACCAAAATAATTTAGATAATATTTCTATCCTTGAAGAATCTATCATGCAATCTATG
ATGGATGAAGAGAAAAACACTTAAGATAAAGAGGATGATGAAGAAATTCCAGAAAATAAT
GATAAATAAAATAAAAAAATTAGATCAAGCAAAAACACTAAGAAAATAAGTAGTATTGAT
GTTTATGATGATATTGGTTAAGAATTGATTGAATAACTTGAAAATCACAGAGAATCATTA
AAAATTGAAAAGGCTAAGGCTGAAGAAAAATTAAAGAGCATGACTAACGATGCCAACATC
ACTACTATTACTGAATTTAAAAATAAGTACATTGAATTTAAGTCCAAAAAGGAAGAATTT
GAAAGAGTTAAAAATAGAATCTCAGAGCTTAAAGTAGATATTGATCGTCTTAAAAAAGAA
AGATTTGAAAAATTCATGAGCGGCTTTAACCTTATCTCAGCTAAGCTAAAAGAAACATAT
TAAACATTAACAAATGGTGGTGATGCTGAACTTGAATTAATTGACTCTCTCGATCCTTTC
TCAGATGGTGTTAATTTCACAGTAAGACCTCCTAAAAAATCTTGGAAATAAATCTCAAAG
CTATCAGGTGGTGAAAAGACTTTAAGTTCTCTTTCTTTAGTTTTTGCTTTGCATTATTAC
AAGCCAACTCCATTATACTTTATGGATGAAATCGATGCTGCCTTAGATTTCAAGAATGTA
TCAATTGTTGGTAATTATATCCAAGAAAGAACTAAAAATGCACAATTCATTATTATTTCC
TTAAGAAATAATATGTTTGAGCTTGCCAACAAATTAGTTGGAGTCTACAAAACATACGAT
ACTACTAAAACTATTGCAATCATTCCTGAATTAATTTATTAAAAAATTCAACACTTGAAT
GATGATAAGACTGACACTAATTAAAACTAGAATGAAGATAAAGACAATAAGAGCAACTGA


>TTHERM_00446400(protein)
MNQESTSKVQAQMEEEIPTAKSVVKHTQSLLKNSVLRQNLAGKSEQRLIVKQIVLENFKS
YQGRQVIGPFHKRFTSVVGPNGSGKSNLIESLLFVFGKKASWMRLKKLEQLIHNSSKHQN
VKKASVEVTFHEIRDKEGEEYEVIPGTEFTVRRTVNKSSVSKYEINDKEVSHVEVTDTLK
QKGIDLTNNRFLILQGEVEQISLMKPRSGDPEKPGLLEYLEDIIGSNQFKEDIEKKDEEY
EVLQNERREKGERMRIHEADLEKLQESKNLAIEYIRNEKLSYQMTNIIGQIDLLRSKKDI
EKFETKIKQNEQQNVEMREKFKQQLKENEQVIKEYKQSKAEIEKKDYEVQKYKGQLKKLN
ERDELIRQKLVLETENQTKAEKQLEDLQDEYKKAIRDQKEYQSELPEKQDRLRKLLTKKD
DEDEKLRELKSKVNNENQKLVKEKKEMEKKLQPIKEKKLEVQSKRDTLQNRFTLISQDAT
AIQNEYEKNQNELEKAKQLIEDQHTLIKQIAQAIQAIEAGYEKQEADNKECRIIEEKIIK
AISECKQKIDQTKQSNQDSQTRNKVLNELMIAQQQGKLRGICGRLGDLAAINEEYDVAIT
TACGQLDNIIVDRYDDAQNAVNYLRKEKIGKAQFIALDKIEHNRQYMEKQFQCPRGSQRL
FDLIQFKDQKYKVAFYFALRNTLVCDNIDLATEIAYGQQRHRVVTKKGELIDDSGVMSGG
GAARRGGMASQLKVEISPEEVERYQAEYSRNQQDLEQIRETIQNTNKQLNTFIQEKMYLV
KQLEAKKFDQQLQEDNVTRCQNRLKALQKQMDEQEQNAKERQVIKQELEKFESEYHEYDG
QIMELNKKITDIDEKINKSGGQELKQQQEICKNIQNQTLELQADVNKKTAKLKDLEKTLK
NNEREKNETQERIKKIKASIDPLKDQQQKLEEDAVKVFKDQQQAEQQLAMLQEQQKQRDE
QKAGIEKIIKDMKDALEKLKKEKDDFEAKINKAKEDQNRSEHVIANNRNTYKEITKSYDF
LQFIDEIAGYQINESEDKKSDDQNNLDNISILEESIMQSMMDEEKNTQDKEDDEEIPENN
DKQNKKIRSSKNTKKISSIDVYDDIGQELIEQLENHRESLKIEKAKAEEKLKSMTNDANI
TTITEFKNKYIEFKSKKEEFERVKNRISELKVDIDRLKKERFEKFMSGFNLISAKLKETY
QTLTNGGDAELELIDSLDPFSDGVNFTVRPPKKSWKQISKLSGGEKTLSSLSLVFALHYY
KPTPLYFMDEIDAALDFKNVSIVGNYIQERTKNAQFIIISLRNNMFELANKLVGVYKTYD
TTKTIAIIPELIYQKIQHLNDDKTDTNQNQNEDKDNKSN


>TTHERM_00446400(gene)
ATGAGTAAATTATTTTGTTTAGCTTTTCAAAATTAATTTTAGTATTTACATTTTTGCCAC
TTATCTGTATTTTAATTTTATATGAAATTATTTTCTAAAAACAATAATTAGATTAAGAAT
CAACTTCAAAAGTATAAGCATAAATGGAAGAAGAAATACCCACTGCTAAATCAGTTGTTA
AACATACTTAAAGTCTGCTCAAAAATTCGGTTCTGAGATAAAATTTAGGTAAGTATACAT
GCGTTTTCATATTAAAATGCCTACAAATTTATTGCATTATCCCAATTATAAGAACTAGCT
TTTTTTTTACAAGGAATTAGCTTGAAATTTTTATTAAAAGTGCTTCAAATTTTATTCATA
TCTAAAGGATTTTTTTTTTAAATAGCTGGTAAGAGCGAGCAAAGACTTATTGTAAAGTAA
ATCGTGCTTGAAAACTTTAAGAGTTATTAAGGTAGATAAGTTATTGGTCCTTTCCATAAA
AGATTTACTTCCGTTGTTGGGCCTAATGGTAGTGGTAAATCAAACTTGATTGAGTCTCTT
CTTTTCGTATTTGGTAAAAAAGCTTCCTGGATGCGTCTCAAAAAACTTGAATAACTCATT
CATAACTCTTCAAAGCATTAAAATGTTAAAAAAGCTTCTGTCGAAGTTACTTTCCATGAA
ATTAGAGATAAAGTAATTTTCATTTTAGCAGTAGTTAATCAATCTAATATTTAACATTAT
TTTCAAACTAAAAGGAAGGCGAAGAATATGAAGTTATTCCTGGAACTGAATTCACTGTTA
GAAGAACAGTTAATAAATCTAGTGTTTCAAAATACGAGATCAACGATAAAGAAGTATCTC
ATGTAGAAGTTACTGATACTCTTAAATAGAAGGGTATTGATCTTACTAATAACCGTTTCT
TAATTCTTTAAGGTGAAGTAGAGTAAATTTCACTTATGAAGCCTCGTTCTGGAGATCCAG
AAAAACCTGGTTTGCTTGAATATTTGGAAGATATTATAGGTTCTAATTAATTCAAAGAAG
ATATTGAAAAGAAAGACGAAGAATATGAAGTCCTCTAGGTAACTAACTTATTAATTAATT
AAAATGAAAGATTTACTATTTATGATATAAAAAGAATGAAAGAAGAGAAAAGGGAGAAAG
AATGAGAATACACGAAGCTGATTTAGAAAAGCTATAAGAATCTAAGAATTTAGCCATCGA
ATACATTCGTAATGAAAAACTAAGCTATTAAATGACAAATATTATTGGATAGATCGATCT
TTTAAGAAGTAAAAAAGATATAGAAAAGTTTGAAACAAAGATCAAATAAAATGAGCAATA
AAATGTTGAAATGAGAGAAAAATTCAAATAGTAATTAAAGGAAAACGAACAAGTTATCAA
AGAATATAAGCAAAGCAAAGCTGAAATAGAAAAAAAGGATTATGAAGTGTAAAAGTATAA
AGGTCAATTAAAAAAATTGAATGAACGTGATGAATTAATTAGACAAAAGTTAGTATTAGA
AACTGAAAACTAAACTAAAGCTGAGGTAATCAATCAAAATATTTATTTTATTTTTTTATC
CATTTATCAATATAGAGAGTAATTTTTTTTCAATAAAATTTGTAAAAATGGGAAATTGAA
AATAATTAATTATTGTTTATTTGGAAATTTTAGAATTTATTTTTCTGAATATATTTTTTT
CTTTAGAAATAACTTGAAGATCTTCAAGATGAATATAAAAAAGCTATTCGTGATTAAAAA
GAATATCAATCTGAATTGCCAGAAAAGTAAGATAGATTAAGAAAATTATTGACTAAAAAA
GATGACGAAGATGAAAAGCTTAGAGAATTAAAAAGCAAAGTTAACAACGAAAACCAAAAG
TTAGTTAAGGAAAAAAAAGAAATGGAAAAAAAATTATAACCAATTAAGGAGAAAAAACTT
GAAGTTTAATCGAAGAGAGACACACTTTAAAACAGGTTTACTTTGATTTCTCAAGATGCC
ACAGCTATTTAAAATGAATATGAAAAGAATTAAAATGAATTAGAAAAAGCTAAATAATTA
ATAGAAGATTAGCATACATTGATTAAATAAATTGCTTAAGCTATTTAAGCCATTGAAGCA
GGATATGAAAAATAAGAAGCTGATAATAAGGAATGTAGGATTATTGAAGAAAAAATTATT
AAAGCCATTTCTGAATGCAAACAAAAAATTGATTAAACAAAATAATCTAATTAAGACTCT
CAAACAAGAAATAAGGTAAATAAATAAATAAAAATATAATCAGTAACTAAATTATAGAAA
ATAAAATATTTTTTGTAATTAACAAAAATAGGTTTTAAACGAATTAATGATAGCTTAACA
ATAAGGAAAGCTTAGAGGTATTTGTGGAAGATTGGGTGATTTAGCAGCTATCAATGAAGA
ATATGATGTTGCCATAACTACAGCATGTGGTCAATTAGACAATATTATTGTAGATAGGTA
AATTTTTAAAAATCAGAAATACAGTTTTTATTAAATTAGTTTAAAAAAAGATTATTTATT
AATTAAAAAATTAAACTTTTTTTGATTATTAAAAAATCAACATTTAAACTTATTGCAAAT
AATAAAATAATAGATATGATGATGCTTAGAATGCAGTCAATTACTTGAGAAAGGAAAAAA
TTGGTAAAGCTTAATTTATTGCTTTAGATAAAATAGAACATAATAGATAATATATGGAAA
AATAATTCTAATGTCCTAGAGGATCATAGAGATTATTTGATTTAATTTAATTCAAAGATT
AGAAATATAAAGTTGCTTTTTACTTTGCTTTGAGAAATACTTTGGTTTGTGATAACATTG
ATCTTGCTACAGAAATAGCTTATGGTCAATAAAGACATAGAGTATATTACTATATTTCTT
TAATTTTTAAATTAATTGTTTAAATTTATTTAATTAACATTTAAAATTTAGGTAGTCACT
AAAAAAGGAGAATTAATTGATGATTCTGGTGTTATGTCTGGTGGTGGTGCTGCTAGAAGA
GGTGGTATGGCCTCTCAATTAAAAGTGGAGATTTCTCCTGAGGAGGTTGAAAGATATCAA
GCAGAATATAGCAGAAACTAATAAGACTTAGAATAAATTAGAGAAACAATTTAGAATACA
AATAAGTAACTAAACACATTTATTTAGGAAAAGATGTACTTGGTAAAGTAGCTCGAAGCT
AAGAAGTTTGATTAATAATTGTAGGAAGATAATGTAACCAGATGCCAAAATAGACTAAAA
GCTCTTTAAAAGTAAATGGACGAATAAGAATAGAATGCAAAAGAAAGATAAGTCATCAAG
TAGGAACTTGAAAAATTTGAAAGTGAATATCATGAATATGATGGATAAATCATGGAATTA
AATAAAAAAATAACCGATATTGATGAGAAAATTAACAAATCAGGTGGCTAAGAACTTAAG
CAATAACAAGAAATTTGCAAGAATATTTAAAATGTAGCTTTATTTATATTCATTTTTTAA
ATTACTTAGATGATATAATTTTTTTATTTTTTATAAAGTAAACCTTAGAGTTGCAAGCAG
ACGTCAACAAAAAAACTGCTAAATTAAAAGACTTAGAAAAAACTTTAAAGAACAACGAAA
GAGAAAAGAATGAGACATAGGAGAGAATCAAAAAAATAAAAGCTAGTATTGATCCATTAA
AAGATTAGTAATAAAAACTTGAAGAAGATGCTGTTAAGGTATTCAAAGATTAACAATAAG
CTGAATAGCAGTTAGCAATGTTACAAGAGTAGCAAAAGCAAAGAGATGAATAAAAGGCTG
GAATTGAAAAAATTATTAAAGATATGAAGGATGCTTTAGAGAAATTAAAAAAAGAAAAAG
ATGACTTTGAAGCTAAAATTAAGTAAGTTTTGTATTAATAAAAAATATTGATAATAATTT
TCTTTTTATAAAATAAATAGCAAAGCAAAAGAAGATTAGAACAGAAGTGAACATGTTATT
GCCAATAACAGAAATACTTACAAAGAAATTACTAAATCATATGATTTCTTACAATTCATT
GATGAAATTGCTGGCTATTAAATTAATGAGAGTGAGGATAAGAAATCTGATGACCAAAAT
AGTAAAAAAATTTAAATAATTTGCATTATTAAATTAAGCTCTTAATAAAGATTTAGATAA
TATTTCTATCCTTGAAGAATCTATCATGCAATCTATGATGGATGAAGAGAAAAACACTTA
AGATAAAGAGGATGATGAAGAAATTCCAGAAAATAATGATAAATAAAATAAAAAAATTAG
ATCAAGCAAAAACACTAAGAAAATAAGTAGTATTGATGTTTATGATGATATTGGTTAAGA
ATTGATTGAATAACTTGAAAATCACAGAGAATCATTAAAAATTGAAAAGGCTAAGGCTGA
AGAAAAATTAAAGAGCATGACTAACGATGCCAACATCACTACTATTACTGAATTTAAAAA
TAAGTACATTGAATTTAAGTCCAAAAAGGAAGAATTTGAAAGAGTTAAAAATAGAATCTC
AGAGCTTAAAGTAGATATTGATCGTCTTAAAAAAGAAAGATTTGAAAAATTCATGAGCGG
CTTTAACCTTATCTCAGCTAAGCTAAAAGAAACATATTAAGTAAGCTTTTATATTTAATA
AGATAGCATTTTTTTTAATATAAACATTTTATTTAATTTTTTAATTGCAATAAAAACATA
GACATTAACAAATGGTGGTGATGCTGAACTTGAATTAATTGACTCTCTCGATCCTTTCTC
AGATGGTGTTAATTTCACAGTAAGACCTCCTAAAAAATCTTGGAAATAAATCTCAAAGCT
ATCAGGTACATAATTTAAAACATTTTTTAGAAATAAAATTTGATTAATAATTAATTAATT
GTAAAGGTGGTGAAAAGACTTTAAGTTCTCTTTCTTTAGTTTTTGCTTTGCATTATTACA
AGCCAACTCCATTATACTTTATGGATGAAATCGATGCTGCCTTAGATTTCAAGAATGTAT
CAATTGTTGGTAATTATATCCAAGAAAGAACTAAAAATGCACAATTCATTATTATTTCCT
TAAGAAATAATATGTTTGAGCTTGCCAACAAATTAGTTGGAGTCTACAAAACATACGATA
CTACTAAAACTATTGCAATCATTCCTGAATTAATTTATTAAAAAATTCAACACTTGAATG
ATGATAAGACTGACACTAATTAAAACTAGAATGAAGATAAAGACAATAAGAGCAACTGA