Identifiers and Description

Gene Model Identifier

TTHERM_00294810

Standard Name

SMC3 (Structural Maintenance of Chromosomes 3)

Aliases

PreTt15591 | 27.m00251 | 3692.m00054

Description

SMC family; C-terminal domain containing protein; cohesin complex member

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01576 ) Myosin tail
  • ( PF02370 ) M protein repeat
  • ( TIGR01612 ) rhoptry protein
  • ( PF08791 ) Viral envelope protein
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( TIGR00634 ) DNA repair protein RecN
  • ( PF00038 ) Intermediate filament protein
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( TIGR00019 ) peptide chain release factor 1
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( TIGR02168 ) chromosome segregation protein SMC
  • ( TIGR02169 ) chromosome segregation protein SMC
  • ( PF07197 ) Protein of unknown function (DUF1409)
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( TIGR00253 ) conserved hypothetical protein TIGR00253

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00294810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08738.19.997093137033517e-262SMC family domain-containing p
rotein (1161 aa)
SGDYJL074C5.001636743996964e-56SMC3 Subunit of the multiprote
in cohesin complex required fo
r sister chromatid cohesion in
mitotic cells; also required,
with Rec8p, for cohesion and
recombination during meiosis;
phylogenetically conserved SMC
chromosomal ATPase family mem
ber
OxytrichaContig17078.0.g582.000704504372864e-47RecF/RecN/SMC N terminal domai
n
WormBaseWBGene000048731.999534248571833e-46locus:smc-3 status:Confirmed
UniProt:Q9U2C1 protein_id
:CAB57898.4
DictyBaseDDB_G02844991.9993007828132465e-27smc2 on chromosome: 4 position
2051268 to 2054927
Stentor CoeruleusSteCoe_157740.0000000001026187963170189

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23555314: Howard-Till RA, Lukaszewicz A, Novatchkova M, Loidl J (2013) A single cohesin complex performs mitotic and meiotic functions in the protist tetrahymena. PLoS genetics 9(3):e1003418

Sequences

>TTHERM_00294810(coding)
ATGAGCATTAAATCAATATCTATAGAAAAATTTAAAAGTTACTCTAACTGCAAGATAGAA
GGACTCTCTGACAATATAAATATTCTGTATGGCAAGAATGGTTCTGGAAAATCTAATTTG
TTGGCTGCTTTATCATTTATAAGTTCTGATTAGTACGATAGAGCTGATCGAGCATAATTA
ATGAAAAATTATAAAGAAGGTGATCCTAAGGTCGAAATAGAGTTAGATAATTTAGTTAAA
ATAGATAAAAAAGATATGGAAGATGAGCCAAAAGCACAAAAAGTTATTCCTACCAGCGGT
GATAGTGTTTTATTAAGTAGAACTTTAGAGTAAAGGGAGAATGTTTATAGGGTAGATGAT
AGAGTTGTTAATTTAAATTAGTTTAATAATATTTTTGAGTGCTTTGGTCTTTCAAGAAAG
AATCCTTTTACAATAGTTGCATAAAATAGAATTTAAGAAATATCAAACATGAGTGATTCA
GAAATCTATAAGTTGTTACAGCAAGTAGCTGGAATAGAAGCTTTTATGAATAAATAAGAA
AAAGCAGAAGAGCTTTTCGAAAAAGCTTAGAGAGAAAAGGAAGGCATAGATTAATCCTTA
CAAGAAATAGAAGATAAAATAAGCTAGTTAAGTGGTGAGAAAGAATAGTATGCACAAAAT
TAAGAATAGGAAATTATTATATAAAGCTTGTAATCTATCTATTATGATAAATTGAAAGAA
GAGCTTTAAAAGAAGAAATTAGAATGCAACAAAGAAATCAATAATCAAAAATTGTAAGAA
GAGAAGTAAAAGCTTCAGGATTTATAAAATTAGAAAGAAGCTAAAAATGAAGAACTATTA
AGATTTAAAGAAAAATTGCAAAGATTAACAGTTATAGAAGAGCAAGTAAAATCAGATTAA
ATGAATCTTTAAAACAAAGTCAACAGTCTTGAGTAGAATATCTAAAAATTAAAATCAATA
AAAACTAACAAAGATGAAAAAGAAATTGAAGCAAGATTAAAAGAAGTTAATATTTAATGC
ACTAAATTATAAAAAGATCTTGATGAAGTCATTGATAAAATAACAAATGAAAAAGATGGG
ATTGACACCAAGCAGTAAGAATATGAGCAATTAGTCTTAAGAGAAAAGTTTAAAACTTAG
TAAGAAAAGCAAAGCTATTTTAATCAGAGAATCCAAGACATTAAACAAAGTATTAGTGAA
AAATCATAAACTTAACAGAATCTTAAAGAGAAAGTGAAAAAATCTGAATAAAGACTAAAC
TTAGTTAATTAAGAAATTGAAAAATTGTAAAATCAAATAAATAGTTTTTAAACTGAATCC
AATAAGGCACAAAAAACTATAAATGATAAAAAGAATTAAATCTAAAAATTGAGACAAGAG
TAGCTTGAAAAGAGAAAGACAATTAATGATAAAAAAATAGAGTTGGAAGATTTAAACAAC
TAAATAAAAAAGAGAGTTGATGATATACAAAAGTAGTTGAAATCAGGATTAATCCAAGCA
ATTGAGCAAATCGAGGAATCAATATAAAAAGAAGGTATTTAGGGATATAAAGGACTGCTT
ATAGATCATCTTTAATTTAATTCTGCACTTACTTATGCATATGATATTGCTCAAAAAGGA
AAATTATTTTCTTTGATAGTCGATAATCAAAATACTGCCTCTTTAATAATTGATATTGTT
AAGAAATTGAAGATTAAAACATCAAATTTAAATATTATTCCCCTAGATTGGGTTGAAGAT
GATATTGATGATGAAAAAGAAAACTAAATTGCAGGATTCGGATTTTAAAAGCTATTTGAT
ACTAGGTATGTTAAGGCAAAAGGAGATCATGCAGATGATATAAAAAGGTTAGCTAAGAAT
ATTTTTGAAAAATATGGTGTAATTAAAGAGTATGAACATGCCCTAGAGGTAGCATCTTAA
TTTAAAGTAAACTGCATTACAGAGAAGAGATAAATTGTTTATAGTGGAGGTTTTATTTCT
CATGTTGGTTTTTGTACTGTGGCTAAAGTAGATAAAATAACACTTTACAATGAATACAAA
AGCTTTAAAGCTAAGAAAGATGCTATTGCTAAAGAAATAGAGCAACTAGAGAAGTCTATG
AATGATATTTAATTGTAATAAAATGATATAAATTCAAATGTAAGCAAAGAATAAGCTAGC
TTAGCAAAATAGAGTAACACTATATTTATGAATCGTTAACTAATTAAATCATCTGAAGTA
GAGAAAAAAGTATTGACTGATGAGTTAAACGAAACAAATTAACTCCTATAGTCTTTTTCT
TAATAACTTAAAGATTTAGAATAAGAGAAAATAGGTTTAGAAAATACTAGCAAATCCTCT
AAATTTGAACCCTTGAATTAAGAGGACAAGTAAAAAATGTATAAACTATAAGAAGAAATT
AAGTCTAAAACTACTGTTTTGTAAAAATCTCTGAAAGAAAAGTAAAATGTAGAAAAAGAG
TATAACAAGTATAGAAATGAAGAATAATAGCTAACTAATCATTTATCCCAATTATCAGAA
GGTGGTGGTATGAAAGATGGTGAAGTCTTATTTTAAAGCATTGATCAAAGAATAAGTTCT
TCAGAGTAAGACCTCAAACATCAAGAAAGTATTCTCAAAGCTTAAAAAGCAATTGTGGAA
AAAGCTACACAAAGTAAGAAAACACTCGAAGAATAAATAAAAAAGATTGAGGGAGAAAGC
TAAGATAAGCTGAAAGAGCAAATTCAAAGCTAGTAAGAACTTTGCAATAATTTAGAATAA
TAAATCAGTGCTTTACTTCTCCGTAAACAACAATATATTTCAAAAGAGTACGAAATAGAT
TAAAAAAAGGAATTACTAGTAGTAAGCCCTGATTTTATCCAAAAAAATTCTCATCTTTCT
AAAGATAATTTAAAAGATAAGCTGAATAGAATTACTTAATAAACAACCATTAAGAAATAC
ACAGCAAAAGATAAAATTCTATTTGAAAAATTAAAAGATTTGGACGAGAAATATGAAGAA
TACAAATCCAAATACACTGAATTAACAAAAAATGAAGAATAAGCCAAAAATCTAATTGAT
TAATTTAAATCAAAATGTGAATAAACTATTAAAATGGCATTTTCTAAGTTTGAGCATTAT
ATGAAAAATTATTTCAAATAAATATCTTCTGCAGGTACAATAGACGTTAAACTTATGCAT
AATCATGAAATCAGTATATCAGTTGCTTTTAAATAAACTACAAATGAAACAAAAAAGACA
AATAGAAAAGAGCTAAGTGGAGGAGAAAAGAGTTGTCTTGCTATTCTTATTTTAATGGCT
CTATAGAGATGTGATCCAGCTCCATACTATATATTTGATGAATTTGATGCAGCATTAGAC
GCTGGTTATATTAGACCTATTGCAAAGATGTAAGTTAATTTTTAATTAAGTATTAAATTA
ATAACACATACTTATTTATTTATTTACTATTACGCAAAAGAATATCTGAAAATAGCTAAA
AGTCTTAATTTTTAATTGTTTCACACAAGTTTGAATTTTTATAAGCTTTACAACAAGAAA
ATTGTAAGTGCTTCTAGATATCACTAAAAGACAAAATAAGCGAGATAGAAGAGAAGACTT
TATCAGCTGCAATAAATTTTGTTAAAAATGGTTGAAAATGTGTTAAAAAGATAAATAGTT
TTTCCAAAAATTAGTCTCCATATAATTAATTATAAATTAAAATATTTTTCCATATATTTA
TTAACTGTATGTAATTTTAATCTAAATCATCAAATAGAGCATTCATTTTTTTTTTTAGCT
TACAAAATTTGTGGCTTATAATTCAATCTTATTTATTTAATTAATTTTAATTAAGAAGCT
GCTTAATTTTCTTGTGTTTATTTATGA


>TTHERM_00294810(protein)
MSIKSISIEKFKSYSNCKIEGLSDNINILYGKNGSGKSNLLAALSFISSDQYDRADRAQL
MKNYKEGDPKVEIELDNLVKIDKKDMEDEPKAQKVIPTSGDSVLLSRTLEQRENVYRVDD
RVVNLNQFNNIFECFGLSRKNPFTIVAQNRIQEISNMSDSEIYKLLQQVAGIEAFMNKQE
KAEELFEKAQREKEGIDQSLQEIEDKISQLSGEKEQYAQNQEQEIIIQSLQSIYYDKLKE
ELQKKKLECNKEINNQKLQEEKQKLQDLQNQKEAKNEELLRFKEKLQRLTVIEEQVKSDQ
MNLQNKVNSLEQNIQKLKSIKTNKDEKEIEARLKEVNIQCTKLQKDLDEVIDKITNEKDG
IDTKQQEYEQLVLREKFKTQQEKQSYFNQRIQDIKQSISEKSQTQQNLKEKVKKSEQRLN
LVNQEIEKLQNQINSFQTESNKAQKTINDKKNQIQKLRQEQLEKRKTINDKKIELEDLNN
QIKKRVDDIQKQLKSGLIQAIEQIEESIQKEGIQGYKGLLIDHLQFNSALTYAYDIAQKG
KLFSLIVDNQNTASLIIDIVKKLKIKTSNLNIIPLDWVEDDIDDEKENQIAGFGFQKLFD
TRYVKAKGDHADDIKRLAKNIFEKYGVIKEYEHALEVASQFKVNCITEKRQIVYSGGFIS
HVGFCTVAKVDKITLYNEYKSFKAKKDAIAKEIEQLEKSMNDIQLQQNDINSNVSKEQAS
LAKQSNTIFMNRQLIKSSEVEKKVLTDELNETNQLLQSFSQQLKDLEQEKIGLENTSKSS
KFEPLNQEDKQKMYKLQEEIKSKTTVLQKSLKEKQNVEKEYNKYRNEEQQLTNHLSQLSE
GGGMKDGEVLFQSIDQRISSSEQDLKHQESILKAQKAIVEKATQSKKTLEEQIKKIEGES
QDKLKEQIQSQQELCNNLEQQISALLLRKQQYISKEYEIDQKKELLVVSPDFIQKNSHLS
KDNLKDKLNRITQQTTIKKYTAKDKILFEKLKDLDEKYEEYKSKYTELTKNEEQAKNLID
QFKSKCEQTIKMAFSKFEHYMKNYFKQISSAGTIDVKLMHNHEISISVAFKQTTNETKKT
NRKELSGGEKSCLAILILMALQRCDPAPYYIFDEFDAALDAGYIRPIAKMQVNFQLSIKL
ITHTYLFIYYYAKEYLKIAKSLNFQLFHTSLNFYKLYNKKIVSASRYHQKTKQARQKRRL
YQLQQILLKMVENVLKRQIVFPKISLHIINYKLKYFSIYLLTVCNFNLNHQIEHSFFFLA
YKICGLQFNLIYLINFNQEAAQFSCVYL


>TTHERM_00294810(gene)
ATGAGCATTAAATCAATATCTATAGAAAAATTTAAAAGTTACTCTAACTGCAAGATAGAA
GGACTCTCTGACAATATAAATATTCTGTATGGCAAGAATGGTTCTGGAAAATCTAATTTG
TTGGCTGGTACATAAAAAATATTACTTAGAAATTTAGCTTTTAATATATTTTTTTTGCTA
AAATTAGCTTTATCATTTATAAGTTCTGATTAGTACGATAGAGCTGATCGAGCATAATTA
ATGAAAGTAATATATATTTTCATAAATAAATTCTAAATTAAGAACTAACCTATTTTTATT
TTATATAGAATTATAAAGAAGGTGATCCTAAGGTCGAAATAGAGTTAGATAATTTAGTTA
AAATAGATAAAAAAGATATGGAAGATGAGCCAAAAGCACAAAAAGTTATTCCTGTACTCT
TTTTTATGAGTTTTATTAATTTAATTATTTTGTATTATTGTTCAAATTGATGAAAAATGT
TAATTTTTATTTAATATTCTTATTTAGACCAGCGGTGATAGTGTTTTATTAAGTAGAACT
TTAGAGTAAAGGGAGAATGTTTATAGGGTAGATGATAGAGTTGTTAATTTAAATTAGTTT
AATAATATTTTTGAGTGCTTTGGTCTTTCAAGAAAGAATCCTTTTACAATAGTTGCATAA
AATAGAATTTAAGAAATATCAAACATGAGTGATTCAGAAATCTATAAGTTGTTACAGCAA
GTAGCTGGAATAGAAGCTTTTATGAATAAATAAGAAAAAGCAGAAGAGCTTTTCGAAAAA
GCTTGTAATTTTTTATTTTAATACTAAATAATAATATGAAGGAAATATAATTTTAAAGAG
AGAGAAAAGGAAGGCATAGATTAATCCTTACAAGAAATAGAAGATAAAATAAGCTAGTTA
AGTGGTGAGAAAGAATAGTATGCACAAAATTAAGAATAGGAAATTATTATATAAAGGTAT
AAAAAACATTATTGCCTTTGAAAATATAAATATGTTTTTTTAATATTTTATTAGCTTGTA
ATCTATCTATTATGATAAATTGAAAGAAGAGCTTTAAAAGAAGAAATTAGAATGCAACAA
AGAAATCAATAATCAAAAATTGTAAGAAGAGAAGTAAAAGCTTCAGGATTTATAAAATTA
GAAAGAAGCTAAAAATGAAGAACTATTAAGATTTAAAGAAAAATTGCAAAGATTAACAGT
TATAGAAGAGCAAGTAAAATCAGATTAAATGAATCTTTAAAACAAAGTCAACAGTCTTGA
GTAGAATATCTAAAAATTAAAATCAATAAAAACTAACAAAGATGAAAAAGAAATTGAAGC
AAGATTAAAAGAAGTTAATATTTAATGCACTAAATTATAAAAAGATCTTGATGAAGTCAT
TGATAAAATAACAAATGAAAAAGATGGGTAAATAAATCATTTTAATATGAATAAAAAAAT
TTTTATTGATGTTTAATTTTGATAAAGGATTGACACCAAGCAGTAAGAATATGAGCAATT
AGTCTTAAGAGAAAAGTTTAAAACTTAGTAAGAAAAGCAAAGCTATTTTAATCAGAGAAT
CCAAGACATTAAACAAAGTATTAGTGAAAAATCATAAACTTAACAGAATCTTAAAGAGAA
AGTGAAAAAATCTGAATAAAGACTAAACTTAGTTAATTAAGAAATTGAAAAATTGTAAAA
TCAAATAAATAGTTTTTAAACTGAATCCAATAAGGCACAAAAAACTATAAATGGTAATTA
ATTAATTAAAATATTTAAATTATTTTTATTAACTTAAAATTAGATAAAAAGAATTAAATC
TAAAAATTGAGACAAGAGTAGCTTGAAAAGAGAAAGACAATTAATGATAAAAAAATAGAG
TTGGAAGATTTAAACAACTAAATAAAAAAGAGAGTTGATGATATACAAAAGTAGTTGAAA
TCAGGATTAATCCAAGCAATTGAGCAAATCGAGGAATCAATATAAAAAGAAGGTATTTAG
GGATATAAAGGACTGCTTATAGATCATCTTTAATTTAATTCTGCACTTACTTATGCATAT
GATATTGCTCAAAAAGGTATTTCACATTTTTTATTTTTCTTGCAAATATTTATTTTTTTA
TAAACTTATTGCTAGGAAAATTATTTTCTTTGATAGTCGATAATCAAAATACTGCCTCTT
TAATAATTGATATTGTTAAGAAATTGAAGATTAAAACATCAAATTTAAATATTATTCCCC
TAGATTGGGTTGAAGATGATATTGATGATGAAAAAGAAAACTAAATTGCAGGATTCGGAT
TTTAAAAGCTATTTGATACTAGGTATGTTAAGGCAAAAGGAGATCATGCAGATGATATAA
AAAGGTTAGCTAAGAATATTTTTGAAAAATATGGTGTAATTAAAGAGTATGAACATGCCC
TAGAGGTAGCATCTTAATTTAAAGTAAACTGCATTACAGAGAAGAGATAAATTGTTTATA
GTGGAGGTTTTATTTCTCATGTTGGTTTTTGTACTGTGGCTAAAGTAGATAAAATAACAC
TTTACAATGAATACAAAAGCTTTAAAGCTAAGAAAGATGCTATTGCTAAAGAAATAGAGC
AACTAGAGAAGTCTATGAATGATATTTAATTGTAATAAAATGATATAAATTCAAATGTAA
GCAAAGAATAAGCTAGCTTAGCAAAATAGAGTAACACTATATTTATGAATCGTTAACTAA
TTAAATCATCTGAAGTAGAGAAAAAAGTATTGACTGATGAGTTAAACGAAACAAATTAAC
TCCTATAGTCTTTTTCTTAATAACTTAAAGATTTAGAATAAGAGAAAATAGGTTTAGAAA
ATACTAGCAAATCCTCTAAATTTGAACCCTTGAATTAAGAGGACAAGTAAAAAATGTATA
AACTATAAGAAGAAATTAAGTCTAAAACTACTGTTTTGTAAAAATCTCTGAAAGAAAAGT
AAAATGTAGAAAAAGAGTATAACAAGTATAGAAATGAAGAATAATAGCTAACTAATCATT
TATCCCAATTATCAGAAGGTGGTGGTATGAAAGATGGTGAAGTCTTATTTTAAAGCATTG
ATCAAAGAATAAGTTCTTCAGAGTAAGACCTCAAACATCAAGAAAGTATTCTCAAAGCTT
AAAAAGCAATTGTGGAAAAAGCTACACAAAGTAAGAAAACACTCGAAGAATAAATAAAAA
AGATTGAGGGAGAAAGCTAAGATAAGCTGAAAGAGCAAATTCAAAGCTAGTAAGAACTTT
GCAATAATTTAGAATAATAAATCAGTGCTTTACTTCTCCGTAAACAACAATATATTTCAA
AAGAGTACGAAATAGATTAAAAAAAGGAATTACTAGTAGTAAGCCCTGATTTTATCCAAA
AAAATTCTCATCTTTCTAAAGATAATTTAAAAGATAAGCTGAATAGAATTACTTAATAAA
CAACCATTAAGAAATACACAGCAAAAGATAAAATTCTATTTGAAAAATTAAAAGATTTGG
ACGAGAAATATGAAGAATACAAATCCAAATACACTGAATTAACAAAAAATGAAGAATAAG
CCAAAAATCTAATTGATTAATTTAAATCAAAATGTGAATAAACTATTAAAATGGCATTTT
CTAAGTTTGAGCATTATATGAAAAATTATTTCAAATAAATATCTTCTGCAGGTACAATAG
ACGTTAAACTTATGCATAATCATGAAATCAGTATATCAGTTGCTTTTAAATAAACTACAA
ATGGTATTTTTAAAGCATCAAAAAAAAGTATTTAACAAAATATTTATTATATTAGAAACA
AAAAAGACAAATAGAAAAGAGCTAAGTGGAGGAGAAAAGAGTTGTCTTGCTATTCTTATT
TTAATGGCTCTATAGAGATGTGATCCAGCTCCATACTATATATTTGATGAATTTGATGCA
GCATTAGACGCTGGTTATATTAGACCTATTGCAAAGATGTAAGTTAATTTTTAATTAAGT
ATTAAATTAATAACACATACTTATTTATTTATTTACTATTACGCAAAAGAATATCTGAAA
ATAGCTAAAAGTCTTAATTTTTAATTGTTTCACACAAGTTTGAATTTTTATAAGCTTTAC
AACAAGAAAATTGTAAGTGCTTCTAGGTAAATATTGAATTTCAATTACTCTATTAAAATT
AATTTAAATAATAGATATCACTAAAAGACAAAATAAGCGAGATAGAAGAGAAGACTTTAT
CAGCTGCAATAAATTTTGTTAAAAATGGTTGAAAATGTGTTAAAAAGATAAATAGTTTTT
CCAAAAATTAGTCTCCATATAATTAATTATAAATTAAAATATTTTTCCATATATTTATTA
ACTGTATGTAATTTTAATCTAAATCATCAAATAGAGCATTCATTTTTTTTTTTAGCTTAC
AAAATTTGTGGCTTATAATTCAATCTTATTTATTTAATTAATTTTAATTAAGAAGCTGCT
TAATTTTCTTGTGTTTATTTATGA