Identifiers and Description

Gene Model Identifier

TTHERM_00812950

Standard Name

SMC2 (structural maintenance of chromosomes)

Aliases

PreTt30001 | 138.m00121

Description

SMC family, C-terminal domain containing protein, condensin subunit, required for division of MIC and MAC.

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF01576 ) Myosin tail
  • ( PF00435 ) Spectrin repeat
  • ( PF02370 ) M protein repeat
  • ( TIGR00634 ) DNA repair protein RecN
  • ( PF00769 ) Ezrin/radixin/moesin family
  • ( PF02463 ) RecF/RecN/SMC N terminal domain
  • ( TIGR02473 ) flagellar export protein FliJ
  • ( PF06470 ) SMC proteins Flexible Hinge Domain
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF00005 ) ABC transporter, ATP-binding protein
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( TIGR02168 ) chromosome segregation protein SMC
  • ( TIGR02169 ) chromosome segregation protein SMC
  • ( PF04508 ) Viral A-type inclusion protein repeat
  • ( PF06975 ) Protein of unknown function (DUF1299)
  • ( TIGR03185 ) DNA sulfur modification protein DndD
  • ( TIGR00650 ) GTP-binding conserved hypothetical protein
  • ( TIGR02211 ) lipoprotein releasing system, ATP-binding protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00812950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02981.19.997093137033517e-262SMC family domain-containing p
rotein (1199 aa)
DictyBaseDDB_G02844999.997093137033517e-262smc2 on chromosome: 4 position
2051268 to 2054927
OxytrichaContig3441.0.g499.997093137033517e-262RecF/RecN/SMC N terminal domai
n
WormBaseWBGene000033672.999370583638828e-134locus:mix-1 Mitotic chromoso
me and X-chromosome-associated
protein mix-1 status:Confir
med UniProt:Q09591 protein
_id:CAA87054.1
SGDYFR031C1.9992362000979228e-56SMC2 Subunit of the condensin
complex; essential SMC chromos
omal ATPase family member that
forms a complex with Smc4p to
form the active ATPase; Smc2p
/Smc4p complex binds DNA; requ
ired for clustering of tRNA ge
nes at the nucleolus
Stentor CoeruleusSteCoe_157740.0000000000002543665647376923

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00812950(coding)
ATGTATATAAAAGAAATTATTATTGAAGGTTTCAAGAGTTACGCCACTCGTACAATTATT
AAGGGCTTTGATCAGTAATTCAATGCAATTACAGGTTTTAATGGATCTGGTAAGTCTAAT
ATCTTAGACTCTATCTTATTCGTTCTTGGTTTGAACAAAGATTGGGAACTGCTAAGAGTT
AAGAAGGTTCAAGAATTAGTTTATAAATAAGGTCATGCAGGTATAACAAAAGCAGAAGTT
ACAGTTATTTTCGACAATTCTAACAAAGAATAATCACCTCTTGGTTATGAATCATATGAC
ACAATTTCTGTTACTAGACAAGTCTAATAAGAAAAGAGTAAATACTTCGTTAATGGTACA
AAGCTTACTTTAAATCAAGTCAAAAATATGTTCAGAAGTGTTTAATTAAATATTGACAAT
CCTCACTTCTTGGTTGCTTAAGGTAGAATTACTAAGATCATCAACTTGAAACCTTAGGAA
CTCATTTCTATGCTTGAAGAAACTGCAGGAACTGCTCTCTACAATGAAAAGAAAAGAGAA
AGTGAAAAAATTATTAAGAAAAAAGAGGAAAAGGTTAAGGAAATCAATGATTTGATTGAT
ACAGATATCCAACCTAAAATGAGAAAGTTGAAAGAGGAAAAAGAACAATATTTGATTTGG
AAGAGCAGCGAAGTTGAAATCAACAAAATGGATAGAAAGCTTAAAGCTTATGAATATTTT
AATAAGAACAATCTTTTAAAGGAAAGAATGAGAGAAATAGAAAGCAAGCAAAGCATTCTC
ACACATGCTTAGAGAGAATTAACTAAGGTTACAAATGATTATTAGCAAGTTATTGATGAA
ATGAAAAACCATGGTAGAAAGCAAGATGCTGAAAAGGATAAACAACTCAGTCGTTATGAA
ATGGCACTGAAAAATTTGGAAGATACTATTTAAAGACAAGAAAAAGATCGTGAAACCATT
AAAAAATTTTAAATATCTTCTTTACAAGAATTAAAGAAGTAGGAAAATAAAGTTCGTTTA
TGCGAAGAAAATATTGCTAAATTTGAAAAGGATTTGGAATACTCTAGATAGTAGCTTGCT
GACCTTCAAGCTGAATATGATTAAAAGAAAGAAAATCTCAACGAAGTTAACAGACTTTCT
AAAAATGATTCTGGTAACATAGATGCTGCAAAGGAATAAGTTGATGAATAAATTGTATTC
ACAAAGAATAAACTCAGAAACTTTAAAAACGACATTGCTAAATTAGAAAATTCCATCAAG
CAAAAGCAAAATATCATCAAGAATTAAAAAGAAAATATTGAAAGTGCCTAAAGAGAAAGA
GAAAGTCTTAGCAAAAAGCTTGAAATCTTAGAAAAAGAAATTAAATAAGTTGAAGATGAC
ATCGATAAATGCACATTCAATGTCAATGAGCTCAGAGCAAGAGAAAACGAAAGAGCTAAC
TATGATCAATAAATTATGAAGCTTAATCACAACCTTGAAAATATTTTGAACCAAAATGGT
AACTGGATTTTCAAGCTTCAATTTAGAGACCCTGAACCTAATTTTGATAGAAGCAAAATT
AAGGGAAGAATTTTGACTTTATTCAAAGTAAAATCTCCTGAATATTTCGAAGCACTTGAA
GCTGGTGCAGGTGGAAAATTGCTAAATATTGTTACTGAAGATGAATAAACTTCTAAGTTA
ATGCTTAAAAAGAATTGCTTCTCTTTTAATGTTAGATTTATTCCTAACAATAAGATTGTT
AGCAGAAAGATTGATGAACAAATAGTTTAAGAAGCTTAACGTATTGCAAATGAAATGGGA
GGATGGGCTCTTCCTGCTTATGAACTTATCGAATATGATAAGTATTTAGAAAGAAGTATG
CTTTTTGTATTTGGAAACTTCATTGTTACTTCTAATCAACATATCGCTAAGTAGATAGCC
TTTAATTAGAATGTTAGAATGAGAATCAAGTGTGTCACTCTCGAAGGTGATATTATTGAT
CCTCAAGGTACTTTATAAGGTGGTTATCAAGATAATAGAAACCTCACACTTACTCGTTAT
GCTAATTATAGAAATATTTAAGACGAGAAAGAAGAAATAATCTACAATAAAGGTCAACTT
TAAGAAAGCATCAACTACCTTAAAAAAGAAGAAAATTATTATAATGGTTTGAAGGATGAT
TTAACAAATAAAAAATTCAGATTTGAAAAATTCGCTGAACAATTAAGAAATCTTTCTGGT
CGTGGTATCCAAGAGCAATAAGATAAGCTTGAAAGAGAAATTCAAGATGATATTGAAATG
CTTGCACGTGTTTAAGATCAAGACAAAAAGACTCAAGAAAAGCTTGAAGAATTGAATAAT
GAAAGAGCTAATCTCTCTAAATCTAAAGACACCAAGGAAGTTTGGAAAAAGAAAATCCAA
AAGCTCAAATAAGAAATAGAAGAAAGTGACAAGGAACTATAAAATTTAAACAATCACATT
GCCGACTGTGAAGTCAATATTGAACATAATAAAAAGGATTTAATCAAATCAAAAGACAGA
GTTATCTAAGAAAATAAAAATATAGAAGATCAAAAGAAAAAACTTGAAAGCAATGACTAA
GATTTGAACCAAAAGAGAAAGGAAAACTAAGAATTGAAGAGACAAAAAGATGAGCTTGAG
CTAGAAATTTAGAAGCTCTAAGGTAAGAGAGTTGAGCTTGAAGAAAAAGAAAAAACTCTT
AAGTAAAGAAAAGACGAAATAGAATCTGAAGTTAAGAAGATCGAAGAATTCAACAAAAAA
ATCACTGCAGAAATTACTGACATTCGTCTTTATCTCAATAATTTAGAAAAAGAAAATGAG
TTTATTAGAAATGATAAAGATCTTTTCGGCTAATAAGGAAGTGAGGACTACGACTTCTCT
AAATTTAACTTAAATGAACTTAAGAGAAGATACCATAACACTGTATAGGAACAACAAATA
AGATAAAAGCAAGTAAACTTTAAGGTTGAGGCCATGAGTGAAAAAGTAGAAAAAGATTAT
TAATAACTTAATGAAAAACGCCAAATTCTTGAAAATGATAAGATCCTCCTTTTCAAGAAC
ATGGACGAATTGGATAAGAAAAAGTAAGAAACTTTAGAAAAATGTTATTTGGAAGTTAAT
AAAACATTTGGCTAAATCTTTTCTGATCTTTTGCCAGGTGCTGCAGCTCGTATATAACCT
CCTGAAGGTCAAGATGTTTCTGCTGGTCTTGAATTGGGTGTTGCTTTCAACAATGTATGG
AAAACTTCTCTATCTGAATTATCAGGAGGTTAAAGATCACTTCTTGCTCTTTCTTTCGTA
CTTGCACTCCTTAAATATAAGCCTGCTCCTTTCTATATTTTGGATGAAGTAGATTCCGCT
TTGGATTTGTCTCATACTGAAAATATAGGTTATATGATTTCTCAAAGATTCCAAAACTCT
CAGTTCCTTCTTATTTCCTTAAAAGACGGTATGTATCAAAATGCTAATGTATTGTTTAAA
ACTTCCTTCGTTGACGGTGTATCTAAAGTTGACAGAATTCCATTAAAGAAAAAAATTACA
AATAACAATAAAAAGAAAAAAATGGAAGTTGAGGATGATAAAGAAAATTAAAATTGA


>TTHERM_00812950(protein)
MYIKEIIIEGFKSYATRTIIKGFDQQFNAITGFNGSGKSNILDSILFVLGLNKDWELLRV
KKVQELVYKQGHAGITKAEVTVIFDNSNKEQSPLGYESYDTISVTRQVQQEKSKYFVNGT
KLTLNQVKNMFRSVQLNIDNPHFLVAQGRITKIINLKPQELISMLEETAGTALYNEKKRE
SEKIIKKKEEKVKEINDLIDTDIQPKMRKLKEEKEQYLIWKSSEVEINKMDRKLKAYEYF
NKNNLLKERMREIESKQSILTHAQRELTKVTNDYQQVIDEMKNHGRKQDAEKDKQLSRYE
MALKNLEDTIQRQEKDRETIKKFQISSLQELKKQENKVRLCEENIAKFEKDLEYSRQQLA
DLQAEYDQKKENLNEVNRLSKNDSGNIDAAKEQVDEQIVFTKNKLRNFKNDIAKLENSIK
QKQNIIKNQKENIESAQRERESLSKKLEILEKEIKQVEDDIDKCTFNVNELRARENERAN
YDQQIMKLNHNLENILNQNGNWIFKLQFRDPEPNFDRSKIKGRILTLFKVKSPEYFEALE
AGAGGKLLNIVTEDEQTSKLMLKKNCFSFNVRFIPNNKIVSRKIDEQIVQEAQRIANEMG
GWALPAYELIEYDKYLERSMLFVFGNFIVTSNQHIAKQIAFNQNVRMRIKCVTLEGDIID
PQGTLQGGYQDNRNLTLTRYANYRNIQDEKEEIIYNKGQLQESINYLKKEENYYNGLKDD
LTNKKFRFEKFAEQLRNLSGRGIQEQQDKLEREIQDDIEMLARVQDQDKKTQEKLEELNN
ERANLSKSKDTKEVWKKKIQKLKQEIEESDKELQNLNNHIADCEVNIEHNKKDLIKSKDR
VIQENKNIEDQKKKLESNDQDLNQKRKENQELKRQKDELELEIQKLQGKRVELEEKEKTL
KQRKDEIESEVKKIEEFNKKITAEITDIRLYLNNLEKENEFIRNDKDLFGQQGSEDYDFS
KFNLNELKRRYHNTVQEQQIRQKQVNFKVEAMSEKVEKDYQQLNEKRQILENDKILLFKN
MDELDKKKQETLEKCYLEVNKTFGQIFSDLLPGAAARIQPPEGQDVSAGLELGVAFNNVW
KTSLSELSGGQRSLLALSFVLALLKYKPAPFYILDEVDSALDLSHTENIGYMISQRFQNS
QFLLISLKDGMYQNANVLFKTSFVDGVSKVDRIPLKKKITNNNKKKKMEVEDDKENQN


>TTHERM_00812950(gene)
ATGTATATAAAAGAAATTATTATTGAAGGTTTCAAGAGTTACGCCACTCGTACAATTATT
AAGGGCTTTGATCAGTAATTCAATGCAATTACAGGTTTTAATGGATCTGGTAAGTCTAAT
ATCTTAGACTCTATCTTATTCGTTCTTGGTTTGAACAAAGATTGGGAACTGGTAATTAAT
TAATTAATTATATTGACTATTCATAACTAGGCTATTAATTTTTACTTTCAGAGAATTAAT
AAATTATTTTATTTTTTTAATAATTCTAGCTAAGAGTTAAGAAGGTTCAAGAATTAGTTT
ATAAATAAGGTCATGCAGGTATAACAAAAGCAGAAGTTACAGTTATTTTCGACAATTCTA
ACAAAGAATAATCACCTCTTGGTTATGAATCATATGACACAATTTCTGTTACTAGACAAG
TAATTTATCATTTGAAATTCTCTTTGTAATTATTTTGCATGTTAAAAACGATATTGTTTT
TACATTCAATAATAATTTTTTTGAAAAATATTTTAAACTTAGGTCTAATAAGAAAAGAGT
AAATACTTCGTTAATGGTACAAAGCTTACTTTAAATCAAGTCAAAAATATGTTCAGAAGT
GTTTAATTAAATATTGACAATCCTCACTTCTTGGTTGCTTAAGGTAGAATTACTAAGATC
ATCAACTTGAAACCTTAGGAACTCATTTCTATGCTTGAAGAAACTGCAGGTATAAAAATT
ACTTTAGAAGGACAGCAAATAACTATTAAATGCTTGCTATTAATTACCTGATAAAAACAA
AATGTGCTTTCGAAAATCACATAAAAACAGCTTTGATATTAAATAACCATTTTGAATTAT
TTAATTTAATAATAAATAACACTTTAATATAAAAATAAGCCAAGAAATATCTTTTTTAAA
TTAAAAGCAAGAAGTTATTTTTAAAAATGGTTTTTGAGAATATTTTTTGGAATATTTTGA
ATAATTAATTTATCATGAATAATTAAAAATAGGAACTGCTCTCTACAATGAAAAGAAAAG
AGAAAGTGAAAAAATTATTAAGAAAAAAGAGGAAAAGGTTAAGGAAATCAATGATTTGAT
TGATACAGATATCCAACCTAAAATGAGAAAGTTGAAAGAGGAAAAAGAACAATATTTGAT
TTGGAAGAGCAGCGAAGTTGAAATCAACAAAATGGATAGAAAGCTTAAAGCTTATGAATA
TTTTAATAAGAACAATCTTTTAAAGGAAAGAATGAGAGAAATAGAAAGCAAGCAAAGCAT
TCTCACACATGCTTAGAGAGAATTAACTAAGGTTACAAATGATTATTAGCAAGTTATTGA
TGAAATGAAAAACCATGGTAGAAAGCAAGATGCTGAAAAGGATAAACAACTCAGTCGTTA
TGAAATGGCACTGAAAAATTTGGAAGATACTATTTAAAGACAAGAAAAAGATCGTGAAAC
CATTAAAAAATTTTAAATATCTTCTTTACAAGAATTAAAGAAGTAGGAAAATAAAGTTCG
TTTATGCGAAGAAAATATTGCTAAATTTGAAAAGGATTTGGAATACTCTAGATAGTAGCT
TGCTGACCTTCAAGCTGAATATGATTAAAAGAAAGAAAATCTCAACGAAGTTAACAGACT
TTCTAAAAATGATTCTGGTAACATAGATGCTGCAAAGGAATAAGTTGATGAATAAATTGT
ATTCACAAAGAATAAACTCAGAAACTTTAAAAACGACATTGCTAAATTAGAAAATTCCAT
CAAGCAAAAGCAAAATATCATCAAGAATTAAAAAGAAAATATTGAAAGTGCCTAAAGAGA
AAGAGAAAGTCTTAGCAAAAAGCTTGAAATCTTAGAAAAAGAAATTAAATAAGTTGAAGA
TGACATCGATAGTAAATTTTTATTATTTTTATTCTTAAATTCAAAATGCTCTATTAAAAA
TAGAATGCACATTCAATGTCAATGAGCTCAGAGCAAGAGAAAACGAAAGAGCTAACTATG
ATCAATAAATTATGAAGCTTAATCACAACCTTGAAAATATTTTGAACCAAAATGGTAACT
GGATTTTCAAGCTTCAAGTAATGAGACATTCATTATTTTTTCATTTAAATCTTTCAATAC
TTGTTTAATCACTTTTGTTTCAAATCAATAAAATATTTTTTTGAAATAATAAAGTTTAGA
GACCCTGAACCTAATTTTGATAGAAGCAAAATTAAGGGAAGAATTTTGACTTTATTCAAA
GTAAAATCTCCTGAATATTTCGAAGCACTTGAAGCTGGTGCAGGTATATTTGAATATTAA
TTAAATTTATTTTACAAAATAAATAAATAAATGCAATAATTTAGGTGGAAAATTGCTAAA
TATTGTTACTGAAGATGAATAAACTTCTAAGTTAATGCTTAAAAAGAATTGCTTCTCTTT
TAATGTTAGATTTATTCCTAACAATAAGATTGTTAGCAGAAAGATTGATGAACAAATAGT
TTAAGAAGCTTAACGTATTGCAAATGAAATGGGAGGATGGGCTCTTCCTGCTTATGAACT
TATCGAATATGATAAGTATTTAGAAAGAAGTATGCTTTTTGTATTTGGAAACTTCATTGT
TACTTCTAATCAACATATCGCTAAGTAGATAGCCTTTAATTAGAATGTTAGAATGAGAAT
CAAGTGTGTCACTCTCGAAGGTGATATTATTGATCCTCAAGGTACTTTATAAGGTGGTTA
TCAAGATAATAGAAACCTCACACTTACTCGTTATGCTAATTATAGAAATATTTAAGACGA
GAAAGAAGAAATAATCTACAATAAAGGTCAACTTTAAGAAAGCATCAACTACCTTAAAAA
AGAAGAAAATTATTATAATGGTTTGAAGGATGATTTAACAAATAAAAAATTCAGATTTGA
AAAATTCGCTGAACAATTAAGAAATCTTTCTGGTCGTGGTATCCAAGAGCAATAAGATAA
GCTTGAAAGAGAAATTCAAGATGATATTGAAATGCTTGCACGTGTTTAAGATCAAGACAA
AAAGACTCAAGAAAAGCTTGAAGAATTGAATAATGAAAGAGCTAATCTCTCTAAATCTAA
AGACACCAAGGAAGTTTGGAAAAAGAAAATCCAAAAGCTCAAATAAGAAATAGAAGAAAG
TGACAAGGAACTATAAAATTTAAACAATCACATTGCCGACTGTGAAGTCAATATTGAACA
TAATAAAAAGGATTTAATCAAATCAAAAGACAGAGTTATCTAAGAAAATAAAAATATAGA
AGATCAAAAGAAAAAACTTGAAAGCAATGACTAAGATTTGAACCAAAAGAGAAAGGAAAA
CTAAGAATTGAAGGTAAGAAAGCACATTTCATTATTCATAAATTAATTATCTCTTTTATA
TAAATTATATAGAGACAAAAAGATGAGCTTGAGCTAGAAATTTAGAAGCTCTAAGGTAAG
AGAGTTGAGCTTGAAGAAAAAGAAAAAACTCTTAAGTAAAGAAAAGACGAAATAGAATCT
GAAGTTAAGAAGATCGAAGAATTCAACAAAAAAATCACTGCAGAAATTACTGACATTCGT
CTTTATCTCAATAATTTAGAAAAAGAAAATGAGGTAATAAATATCATTTAAAAAATATAT
TTTTTTATTCCTTTTTTATATTTAATTCAATCTTACTTAATATCTATTTTTTAGTAGAAA
TCAAATTCTTTTTATTAATTTATCAAAATATTTCTTCTTTTACTTATTTATTTATTTATT
TATTTATTTATTTATTTATTTATTTATTTATTTGAGCAGATGCTTTGAAAAAAAAATTTA
AAATATCCTTAGCTTGTTTCAAATAAGATTTTAATAATTTAATATTTTGAAAATAATTTA
AAGAAAAATGTGATTAATTATTAGAATTATTGTTAAAATTTATAATAAATAATGAATGTA
TTTGTGCTAATTAAATTTTCTATTTTGATAATAAAATTAGTTTATTAGAAATGATAAAGA
TCTTTTCGGCTAATAAGGAAGTGAGGACTACGACTTCTCTAAATTTAACTTAAATGAACT
TAAGAGAAGATACCATAACACTGTATAGGAACAACAAATAAGATAAAAGCAAGTAAACTT
TAAGGTTGAGGCCATGAGTGAAAAAGTAGAAAAAGATTATTAATAACTTAATGAAAAACG
CCAAATTCTTGAAAATGATAAGATCCTCCTTTTCAAGAACATGGACGAATTGGATAAGAA
AAAGTAAGAAACTTTAGAAAAATGTTATTTGGAAGTTAATAAAACATTTGGCTAAATCTT
TTCTGATCTTTTGCCAGGTGCTGCAGCTCGTATATAACCTCCTGAAGGTCAAGATGTTTC
TGCTGGTCTTGAATTGGGTGTTGCTTTCAACAATGTATGGAAAACTTCTCTATCTGAATT
ATCAGGAGGTAATTAACTAACTATTTGATTATAATTATTTAATTTTATTTATTCAATTTT
ATTTATTTAACAGGTTAAAGATCACTTCTTGCTCTTTCTTTCGTACTTGCACTCCTTAAA
TATAAGCCTGCTCCTTTCTATATTTTGGATGAAGTAGATTCCGCTTTGGATTTGTCTCAT
ACTGAAAATATAGGTAAATAAATAAACTATTTCTTTAAATTAAATTACTTTTAACTTAAA
TTAAATAAAGGTTATATGATTTCTCAAAGATTCCAAAACTCTCAGTTCCTTCTTATTTCC
TTAAAAGACGGTATGTATCAAGTAAATCATTTCATCAAAATTATATTTGTGATTGTAAAA
TATATTTTAATTATTAAAGAATGCTAATGTATTGTTTAAAACTTCCTTCGTTGACGGTGT
ATCTAAAGTTGACAGAATTCCATTAAAGAAAAAAATTACAAATAACAATAAAAAGAAAAA
AATGGAAGTTGAGGATGATAAAGAAAATTAAAATTGA