Identifiers and Description

Gene Model Identifier

TTHERM_00999090

Standard Name

SLP1 (Scramblase-like protein 1)

Aliases

PreTt26088 | 189.m00066 | 3819.m00220

Description

Scramblase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.6%

TetraMine Data

TTHERM_00999090

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19764.12.0006597401342834e-129scramblase (270 aa)
WormBaseWBGene000119351.0002869940498747e-21locus:scrm-1 status:Confirme
d UniProt:O45799 protein_i
d:CAB04754.2
OxytrichaContig19049.0.g800.0000000000000299873730555305Scramblase

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00999090(coding)
ATGTATCCACCATAATAGCAATAGTATAATCAATAACCCTATGGTTAAGGTTATGGATAA
TAAGGTATGCCTAACATTTAAATGATGCCTATGCAATAGTATGCAGTAGTGGCTATTTAA
AACGGATTGTAAAAGTTAGCTTCTGCTTAAGGTATATTTATTGAATAGAAGTTAGAAGTC
ATTGAGGCATTGACTGGATGCTAAACTCCTAATGTCTACAAGGTTTATCCTGCTGATGTT
AATGGTATATAAACATCAGATTAAACTATATTCAAGTGTAAAGAACTTAGTAACTGTTGT
GTACGTTAATGCATAGCCCCAAGCTGCCGTCCATTTGATATGGCAGTCACAAATTAGCAA
GGAAAATTAAATTATGGATAACTTTCTGGCTCAACTTTTATTTAAATGTAGCGTCCATTC
AAGTGTACATGCCTTTGCTTCAACCGTCCTGAACTCTCTGTAACAGTTGTAGAAAATGGG
ATGAATTAGTATCTAGGAAAAATTAGAGAACCATTTAGATTTTGTGATCTTTGCGTTGAA
ATTGAAGATGCTGCAGGCAATCTCAAGTTTATAATTTCTGGATCCTGCTGCTAACTTGGT
TATCTTTGTATGGGTTGCCCTTATCAATCTTGCCAAGAATTAACTTTTGAAGTAAAGAAT
CCAGCAGGTGAACTAATTACAAGAATTTTAAAGAAATCTGCAGGTTGTCTAAAGAGTTGT
TTTGGTAAAACAGATAACTTTACTATAGGTTTCCCTCCTGGTTTGTCTCCTGAAGACAAA
GCTCTTTTTATGGCTGCTACTCTTTTAATTGATTATATGTACTTTGAAAATAAAACAGAA
CAACCAAATGATTTATGA


>TTHERM_00999090(protein)
MYPPQQQQYNQQPYGQGYGQQGMPNIQMMPMQQYAVVAIQNGLQKLASAQGIFIEQKLEV
IEALTGCQTPNVYKVYPADVNGIQTSDQTIFKCKELSNCCVRQCIAPSCRPFDMAVTNQQ
GKLNYGQLSGSTFIQMQRPFKCTCLCFNRPELSVTVVENGMNQYLGKIREPFRFCDLCVE
IEDAAGNLKFIISGSCCQLGYLCMGCPYQSCQELTFEVKNPAGELITRILKKSAGCLKSC
FGKTDNFTIGFPPGLSPEDKALFMAATLLIDYMYFENKTEQPNDL


>TTHERM_00999090(gene)
ATAAATATTAATTATCATATAAATTTAATAAAAAGTTAAGTAAAATAAATTATCATCAAT
AAATAAATGTATCCACCATAATAGCAATAGTATAATCAATAACCCTATGGTTAAGGTTAT
GGATAATAAGGTATGCCTAACATTTAAATGATGCCTATGCAATAGTATGCAGTAGTGGCT
ATTTAAAACGGATTGTAAAAGTTAGCTTCTGCTTAAGGTATATTTATTGAATAGAAGTTA
GAAGTCATTGAGGCATTGACTGGATGCTAAACTCCTAATGTCTACAAGGTTTATCCTGCT
GATGTTAATGGTATATAAACATCAGATTAAACTATATTCAAGTGTAAAGAACTTAGTAAC
TGTTGTGTACGTTAATGCATAGCCCCAAGCTGCCGTCCATTTGATATGGCAGTCACAAAT
TAGCAAGGAAAATTAAATTATGGATAACTTTCTGGCTCAACTTTTATTTAAATGTAGCGT
CCATTCAAGTGTACATGCCTTTGCTTCAACCGTCCTGAACTCTCTGTAACAGTTGTAGAA
AATGGGATGAATTAGTATCTAGGAAAAATTAGAGAACCATTTAGATTTTGTGATCTTTGC
GTTGAAATTGAAGATGCTGCAGGCAATCTCAAGTTTATAATTTCTGGATCCTGCTGCTAA
CTTGGTTATCTTTGTATGGGTTGCCCTTATCAATCTTGCCAAGAATTAACTTTTGAAGTA
AAGAATCCAGCAGGTGAACTAATTACAAGAATTTTAAAGAAATCTGCAGGTTGTCTAAAG
AGTTGTTTTGGTAAAACAGATAACTTTACTATAGGTTTCCCTCCTGGTTTGTCTCCTGAA
GACAAAGCTCTTTTTATGGCTGCTACTCTTTTAATTGATTATATGTACTTTGAAAATAAA
ACAGAACAACCAAATGATTTATGA