Identifiers and Description

Gene Model Identifier

TTHERM_00426320

Standard Name

SKP1 (Skp1 homolog)

Aliases

PreTt14067 | 47.m00262 | p20

Description

Skp1 homolog; gene depletion induced telomere elongation; affinity purification enriched for SCF ubiquitin ligase components

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00651 ) BTB/POZ domain
  • ( PF01466 ) Skp1 family, dimerisation domain
  • ( PF03931 ) Skp1 family, tetramerisation domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_00426320

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00167.12.9985100291019436e-113suppressor-kinetochore protein
1 (167 aa)
OxytrichaContig20929.0.g682.000597631390999e-64Skp1 family, dimerisation doma
in
DictyBaseDDB_G02692309.000941515806455e-45fpaA on chromosome: 1 position
3989908 to 3990396
WormBaseWBGene000048072.00017271388466e-38locus:skr-1 status:Confirmed
UniProt:G5ECU1 protein_id
:CAB03110.1
SGDYDR328C7.002264059090237e-38SKP1 Evolutionarily conserved
kinetochore protein that is pa
rt of multiple protein complex
es, including the SCF ubiquiti
n ligase complex, the CBF3 com
plex that binds centromeric DN
A, and the RAVE complex that r
egulates assembly of the V-ATP
ase
Stentor CoeruleusSteCoe_64413.975449735908647e-31

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17220281: Witkin KL, Prathapam R, Collins K (2007) Positive and negative regulation of Tetrahymena telomerase holoenzyme. Molecular and cellular biology 27(6):2074-83

Sequences

>TTHERM_00426320(coding)
ATGGATAAAGGTTCTACAAAGGTCAAATTATTGTCTCTTGAAAACGAAATTATTGAAGTT
GACGAAGAAGTCGCTAAGAAGTCATAGTTAATTAAAAATATGATTGAAGATACTGGAACT
GAAGATGATATTCCAATTCCAAATGTTAAGAAGGAGATTCTTTTAAAAATTTTAGAGTAC
TGCGAAAAGCACAAAAACGATAACCCACCTGAAATCGAAAAGCCATTAACCACCAGCAAT
TTAAGTGAATTAGTAGATCCATATGATGCTAAATTTATTGATATTGAAAATCTCGAATAA
CTCTTTGAAATTATATTAGCTGCTAACTATCTCGATATAAAATCTCTTCTTGACTTAGCT
TGCGCCAAAGTTGCTACTCTTATCAAGAACAAAACTCCTGATGAAATCAGAAAAACTTTC
AACATTCCTAACGACTTTACCCCTGAAGAAGAAGCTCAAATTAGAGAAGAAAATAAATGG
GCTGAAGAAGCCACTTCTTGA


>TTHERM_00426320(protein)
MDKGSTKVKLLSLENEIIEVDEEVAKKSQLIKNMIEDTGTEDDIPIPNVKKEILLKILEY
CEKHKNDNPPEIEKPLTTSNLSELVDPYDAKFIDIENLEQLFEIILAANYLDIKSLLDLA
CAKVATLIKNKTPDEIRKTFNIPNDFTPEEEAQIREENKWAEEATS


>TTHERM_00426320(gene)
ATGGATAAAGGTTCTACAAAGGTCAAATTATTGTCTCTTGAAAACGAAATTATTGAAGTA
ATTAATTAGTTTATTGATTGTTCATTCTTTGCTCATAATGAAGCAAGAGCTTTTTGAGAA
TTATTGTTATCATCATTCTGATGAATGATTAATTATTCATTCATTTAATATTTTTAATTA
ATTATAGGTTGACGAAGAAGTCGCTAAGAAGTCATAGTTAATTAAAAATATGATTGAAGG
TAAATTTATTTTATAGCAATAAATAAACAAAAGCAGCATAATAATAAAATATTTTGGTAA
TTTAAAGATACTGGAACTGAAGATGATATTCCAATTCCAAATGTTAAGAAGGAGATTCTT
TTAAAAATTTTAGAGTACTGCGAAAAGCACAAAAACGATAACCCACCTGAAATCGAAAAG
CCATTAACCACCAGCAATTTAAGTGAATTAGTAGATCCATATGATGCTAAATTTATTGAT
ATTGAAAATCTCGAATAACTCTTTGAAATTATATTAGCTGCTAACTATCTCGATATAAAA
TCTCTTCTTGACTTAGCTTGCGCCAAAGTTGCTACTCTTATCAAGAGTAAGATCAGAAAA
TTAAATAGCTTTTTTGTTTGTTTTCTATGCATGCATTTTATTCTATATTAATTTAACTTC
GCAAGAAAAACGACTATTTCATTAATGTTTTTTTGCAAAAATCTAACCAAAATGCATTAT
AAAAAGAGCTACTAAATGCATATTAGTTGACTTTTTCATTAATATATTTACTTATTTTAA
CTTATAATAGACAAAACTCCTGATGAAATCAGAAAAACTTTCAACATTCCTAACGACTTT
ACCCCTGAAGAAGAAGCTCAAATTAGAGAAGAAAATAAATGGGCTGAAGAAGCCACTTCT
TGA