Identifiers and Description

Gene Model Identifier

TTHERM_00094220

Standard Name

SIT1 (Scramblase In Tetrahymena 1)

Aliases

PreTt16577 | 6.m00651 | 3836.m02234

Description

SIT1 scramblase; Scramblase family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11%

TetraMine Data

TTHERM_00094220

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02583.19.999875542736265e-136scramblase (240 aa)
WormBaseWBGene000119350.0000000020002373268528243locus:scrm-1 status:Confirme
d UniProt:O45799 protein_i
d:CAB04754.2

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:SUPR000287

Sequences

>TTHERM_00094220(coding)
ATGAGCGACTAAACCGAATTAGCCAACGCTAAGCACGTCCTTATTAAACAAAGAATTGAA
TGGTTGGAAATCATTCCTTGCTATGAAGAAGAAAACTCGTATGAAATCCACACTTGTGCC
TCCGATTTCACTTCTCCATCTTAAAATCCTATTGCTACCGTCATTGAAAAGCGTGGAAGT
CTTTGCTGTCTCTTCTGCTGCAAAGCTTTCAGAGAATACGAAAATGAATATCAACACTCA
GGTCTCACTGTTGCTACCTCTCACCGTCCTTACAAGATCCCTATCTGCCAATATGCTTTC
ATTCCTTTGTGCAAACCTGAAATTGATGTCCAAAGAGGTGGTTAACACATTGGTAAGGCT
GAATGGCCTTGCTGGCATCCTTGCTGGCCTGCTAGAGGTTTATTGAGTTGCCAAGAATTC
GATATTAAGGACGCTTAAGGTAACATTATCTACAATATTACTGCTAACTGCCTCTAACTT
GGTTTCATCTGCCCTGTTCTTGGTATCCTTGAACCATGCAAGACTAGGGAATATGAAATC
AGAAATGCTGATAAGGTTGTTGTTGGTAAGATCGTAAATATCTACAATGGTATCCTTGAA
GAATGCTGCACTAGAGCTGATTAGTTCGGTATTTAATTCCCTGATGACTGCACTGTTGAA
CAAAAGCTCCTTATCATTGAAACCGCTGTTTTCCTTGATTACCTCTAATATTGGGCTTGA


>TTHERM_00094220(protein)
MSDQTELANAKHVLIKQRIEWLEIIPCYEEENSYEIHTCASDFTSPSQNPIATVIEKRGS
LCCLFCCKAFREYENEYQHSGLTVATSHRPYKIPICQYAFIPLCKPEIDVQRGGQHIGKA
EWPCWHPCWPARGLLSCQEFDIKDAQGNIIYNITANCLQLGFICPVLGILEPCKTREYEI
RNADKVVVGKIVNIYNGILEECCTRADQFGIQFPDDCTVEQKLLIIETAVFLDYLQYWA


>TTHERM_00094220(gene)
ATGAGCGACTAAACCGAATTAGCCAACGCTAAGCACGTCCTTATTAAACAAAGAATTGAA
TGGTTGGAAATCATTCCTTGCTATGAAGAAGAAAACTCGTACTTGATTACTTTATTCATT
TATCAAATAACTTTTATTAAAATAATCATAATAATCAATACTATGTCCCTCATAAAATAT
CATCAAACATATTAGCCAGCACTTAAAATTTGTTTTTTACTGGGATTTTAACTAAAAAAT
TTATAATACCTGATATATTTTTAATAAAATGAAAGAATTATCTTCTAAATAAAATACTTT
ATAATAAAAAAGGTATGAAATCCACACTTGTGCCTCCGATTTCACTTCTCCATCTTAAAA
TCCTATTGCTACCGTCATTGAAAAGCGTGGAAGTCTTTGCTGTCTCTTCTGCTGCAAAGC
TTTCAGAGAATACGAAAATGAATATCAACACTCAGGTCTCACTGTTGCTACCTCTCACCG
TCCTTACAAGTAAAATATTTAATATGAGTTTATCTATTATTTTATAATATAATACTCTCT
TACTTTAATTTTTAATAAAGACTTATCATCTAATACCATATTTTTTTTAACAAAATAGGA
TCCCTATCTGCCAATATGCTTTCATTCCTTTGTGCAAACCTGAAATTGATGTCCAAAGAG
GTGGTTAACACATTGGTAAGGCTGAATGGCCTTGCTGGCATCCTTGCTGGCCTGGTAATT
ATTTAATTATATATTAATGAAAAATACTATTATAACAAAATACCAAATCAACTTACAATT
AAACAAATAATCTTATCCAATATATGAATTTTTTAATTTGTCATTGCTTCTGAATAGAAG
TTATCTCAGTTGATGTTATAATACCTTTTGCTACTGCAAAAGCTTACATTATTCTTAAAA
TAAAAAACATAAACTAAATTTAATTTATAATATAAATAGCTAGAGGTTTATTGAGTTGCC
AAGAATTCGATATTAAGGACGCTTAAGGTAACATTATCTACAATATTACTGCTAACTGCC
TCTAACTTGGTTTCATCTGCCCTGTTCTTGGTATCCTTGAACCATGCAAGACTAGGGAAT
ATGAAATCAGAAATGCTGATAAGGTTGTTGTTGGTAAGATCGTAAATATCTACAATGGTA
TCCTTGAAGAATGCTGCACTAGAGCTGATTAGTTCGGTATTTAATTCCCTGATGACTGCA
CTGTTGAACAAAAGCTCCTTATCATTGAAACCGCTGTTTTCCTTGATTACCTCTAATATT
GGGCTTGA