Identifiers and Description

Gene Model Identifier

TTHERM_00497540

Standard Name

SHQ1 (Small nucleolar RNAs of the box H/ACA family Quantitative accumulation)

Aliases

PreTt06919 | 62.m00203 | 3715.m00064

Description

Homolog of S. cerevisiae SHQ1 chaperone protein required for the assembly of box H/ACA snoRNPs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.3%

TetraMine Data

TTHERM_00497540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12727.19.997093137033517e-262hypothetical protein (432 aa)
OxytrichaContig19252.0.g513.0009061039838537e-46SHQ1 protein
WormBaseWBGene000216557.996378988338516e-41Protein SHQ1 homolog status:
Confirmed UniProt:Q9TYM6 p
rotein_id:CCD71630.1
DictyBaseDDB_G02693042.0008113830639685e-30DDB_G0269304 on chromosome: 1
position 2484101 to 2485936
SGDYIL104C7.996210139153865e-29SHQ1 Chaperone protein require
d for the assembly of box H/AC
A snoRNPs and thus for pre-rRN
A processing, forms a complex
with Naf1p and interacts with
H/ACA snoRNP components Nhp2p
and Cbf5p; homology with known
Hsp90p cochaperones
Stentor CoeruleusSteCoe_160065.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00497540(coding)
ATGATCATCCCCTAATTTAAGCTTACTCAGGATAGTAAATACGTAGTAGCAGTTATTCGT
ATTCCTTATGTTAAAATAAGTAATGCAGAATTCTATATTGAAGGAAGGAACTTTAAATTC
TTTTTGCATCCTTACCTTTTATCAATAGAATTTAAAAATGATTTATTTAAGTCTGATGAA
CCAGCTGCTGCTTCATACAATCATGATACCTATGAGTTAACAGTTAAAATTTAGAAGGCT
ACTGAAGGTGAGCATTTTGAAGATTTAGATATGATAACTTAATTGCTTGCAGCTAGTAGA
AAAAAAGAAGTGAAAAAACCTGAATAGAAAAAAAATAAAAAACCATTAATCGAAGTAATA
GGAGAGGCAGATCATACTGAATAGACTAATAACGATGAAATTGAAGAGATCAAATAGCAA
GTTGAGAACTTGGTTTTGTCCTAAGACGCATATGCTTATGGATTTAATTAATAAACTAAA
GGTTATTTCTAAGATCTTGGTGAAGAAATATTTGAAATTGGTCACTTTAACCCAGACGAA
ATACCTATAAGTGATAGAATTAATTTAAGAAATGAATATGTAAATAGCAAGTTTGATGAA
GATGCTTATATCTATGATACATTTGAAAATGAGGAGATAGACTCATATATTAAATTAAAT
TTAGAATTTTTATCAAAAGTAGCTTCAATTAATTAAGATACAAGCTCTTCTTACACTCCC
GAAGAATGGAACTAGTTAAAAAAATTGCCAAATAAAGAATTCATAATAAATAATAAAAAT
AAATGTTTGATGGAAATTATTGATATCTTGTTTGCATTTGCATACGAATTAAGATGTATG
GGAGGAGAATTTTCTTGTGAAAGTGCTGCAACTATAAACTATTTATCAAGTGTTTTGAGC
TGTTTCATCTGCGATAATACCCTGAACGAAATAATCAGATAGTGCTACAGAAGGGCTTTA
ACTTTCCCTATGTTAAGAAATTTTAAATTAATTTAATAGGCATAACAGGATTTAGTAATA
ATACTTTAAAGTGGTAGAGCTGGAGTTCTTAAAACTTTACTTTAAATTAAATACTTGTTT
GAAGTTAACGAACCTAGATACCATTTAAATAATTTATACATTGAAGATTTTTGTATATGG
GTTTAAACACTCAAAGATGAAGATTTTTAAAATCTTGCAGGGCAAATTTAACAGATAGAA
ATTAATAAAAAAGATCTGGATCTCAATTTAGTAGAAATAGATTAAGACTGTGAATAAATG
CTTCTTGAATAATAAGAAAGTGATAAGCATGATTGA


>TTHERM_00497540(protein)
MIIPQFKLTQDSKYVVAVIRIPYVKISNAEFYIEGRNFKFFLHPYLLSIEFKNDLFKSDE
PAAASYNHDTYELTVKIQKATEGEHFEDLDMITQLLAASRKKEVKKPEQKKNKKPLIEVI
GEADHTEQTNNDEIEEIKQQVENLVLSQDAYAYGFNQQTKGYFQDLGEEIFEIGHFNPDE
IPISDRINLRNEYVNSKFDEDAYIYDTFENEEIDSYIKLNLEFLSKVASINQDTSSSYTP
EEWNQLKKLPNKEFIINNKNKCLMEIIDILFAFAYELRCMGGEFSCESAATINYLSSVLS
CFICDNTLNEIIRQCYRRALTFPMLRNFKLIQQAQQDLVIILQSGRAGVLKTLLQIKYLF
EVNEPRYHLNNLYIEDFCIWVQTLKDEDFQNLAGQIQQIEINKKDLDLNLVEIDQDCEQM
LLEQQESDKHD


>TTHERM_00497540(gene)
ATGATCATCCCCTAATTTAAGCTTACTCAGGATAGTAAATACGTAGTAGCAGTTATTCGT
ATTCCTTATGTTAAAATAAGTAATGCAGAATTCTATATTGAAGGAAGGAACTTTAAATTC
TTTTTGCATCCTTACCTTTTATCAATAGAATTTAAAAATGATTTATTTAAGTCTGATGAA
CCAGCTGCTGCTTCATACAATCATGATACCTATGAGTTAACAGTTAAAATTTAGAAGGCT
ACTGAAGGTGAGCATTTTGAAGATTTAGATATGATAACTTAATTGCTTGCAGCTAGTAGA
AAAAAAGAAGTGAAAAAACCTGAATAGAAAAAAAATAAAAAACCATTAATCGAAGTAATA
GGAGAGGCAGATCATACTGAATAGACTAATAACGATGAAATTGAAGAGATCAAATAGCAA
GTTGAGAACTTGGTTTTGTCCTAAGACGCATATGCTTATGGATTTAATTAATAAACTAAA
GGTTATTTCTAAGATCTTGGTGAAGAAATATTTGAAATTGGTCACTTTAACCCAGACGAA
ATACCTATAAGTGATAGAATTAATTTAAGAAATGAATATGTAAATAGCAAGTTTGATGAA
GATGCTTATATCTATGATACATTTGAAAATGAGGAGATAGACTCATATATTAAATTAAAT
TTAGAATTTTTATCAAAAGTAGCTTCAATTAATTAAGATACAAGCTCTTCTTACACTCCC
GAAGAATGGAACTAGTTAAAAAAATTGCCAAATAAAGAATTCATAATAAATGTAAATAAA
ATTACTTATTTTAAATTTAAAAAAAAGATAAATATTCAAAAATAATTTTTAATTTTTTAA
ACAAACTAGAATAAAAATAAATGTTTGATGGAAATTATTGATATCTTGTTTGCATTTGCA
TACGAATTAAGATGTATGGGAGGAGAATTTTCTTGTGAAAGTGCTGCAACTATAAACTAT
TTATCAAGTGTTTTGAGCTGTTTCATCTGCGATAATACCCTGAACGAAATAATCAGATAG
TGCTACAGAAGGGCTTTAACTTTCCCTATGTTAAGAAATTTTAAATTAATTTAATAGGCA
TAACAGGATTTAGTAATAATACTTTAAAGTGGTAGAGCTGGAGTTCTTAAAACTTTACTT
TAAATTAAATACTTGTTTGAAGTTAACGAACCTAGATACCATTTAAATAATTTATACATT
GAAGATTTTTGTATATGGGTTTAAACACTCAAAGATGAAGATTTTTAAAATCTTGCAGGG
CAAATTTAACAGATAGAAATTAATAAAAAAGATCTGGATCTCAATTTAGTAGAAATAGAT
TAAGACTGTGAATAAATGCTTCTTGAATAATAAGAAAGTGATAAGCATGATTGA