Identifiers and Description

Gene Model Identifier

TTHERM_01030000

Standard Name

SGS1 (Homolog of budding yeast Sgs1 and fission yeast rqh1)

Aliases

PreTt10830 | 204.m00059

Description

SGS1 ATP-dependent DNA helicase RecQ family protein; ATP-dependent DNA helicase- RecQ family protein; Protein involved in DNA joint molecule resolution dHJ dissolution and crossing over

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01202 ) shikimate kinase
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08839 ) DNA replication factor CDT1 like
  • ( TIGR00643 ) ATP-dependent DNA helicase RecG
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF06827 ) Zinc finger found in FPG
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR03158 ) CRISPR-associated helicase, Cyano-type
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.4%

TetraMine Data

TTHERM_01030000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10497.19.997093137033517e-262ATP-dependent DNA helicase, Re
cQ family protein (1193 aa)
OxytrichaContig17511.0.g631.999149254372995e-126DEAD/DEAH box helicase
DictyBaseDDB_G02921301.9992982665753866e-121blm on chromosome: 6 position
1240457 to 1244236
SGDYMR190C1.0002857351297358e-115SGS1 Nucleolar DNA helicase of
the RecQ family; involved in
genome integrity maintenance;
regulates chromosome synapsis
and meiotic joint molecule/cro
ssover formation; potential ro
le as repressor of a subset of
rapamycin responsive genes; r
apidly lost in response to rap
amycin in Rrd1p-dependent mann
er; similar to human BLM and W
RN proteins implicated in Bloo
m and Werner syndromes
WormBaseWBGene000193342.999180586171967e-98Putative ATP-dependent DNA hel
icase Q1 status:Confirmed
UniProt:Q9TXJ8 protein_id:CC
D61880.1
Stentor CoeruleusSteCoe_287672.572209372642415e-56

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43
  2. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_01030000(coding)
ATGGATGAAATATTGTAGTAATTTATAGATAGCAAAAGATAAGCAAAGAAGATAGAAGAT
TTTGCAGACGCTGTATCATGCAGTGCCACAGAAAGCTTAGAAGATTAGGACTAATCTTTT
GATAGAGGTGCTGATTTCAACGATGGAGAAGTAGATGATGCTTTATTGGATGAACTTATA
GAATATTAAACAAACAGAGAGCGTTAATCAATTACTGAAGAGTAAAATGATCTCATGAAA
ACTGAATTGTAAAAGCCAATAAGCAACAATTTAAATAAAAAATAACCAACTAGCTTGAGC
GGTTTGCAAAAAGGGTTAGGAAACAAAATATCTGGACCTTCTTATGATTTTAGTAACTCT
AATAATATGTAGACATTAAGCGGCATTTATAGTTCAAATTCTAACAATAACTCTTAGAAC
AGCAATGAGAACTTTAATTTCAATAGACAAGGAAATACTACTCTAAAGCCTACGGGTTTT
GATGCTATCAAGCTTAAAAAAAATTAGAATTAAGATTAATAGTAATAATAATAGCAATAG
CAAGTTCTGAAATTTGTAAATTAAAATAGTAATGGAGGGATTTAAGTAGAGGCTTCTTTA
ACAGATAAAAGAAGATAAGTAAATAACTCTAATGATATTGATAGTTTCATGTTGATCAAT
AACGGATAAAAAGAAAAAAAGACAAAAAATTAAAATTCTAAAATAAGTGAGTTGCTTGAG
AAGTACAAAGTGATAGATTCTAATTCAAATACTTAAAATTTCGAGTCTACTTCGCTTAAT
ACTTCTCTCAATACCAAAAATAATAAATTAGAAGTTAAAAATGGGTTTTAAAATTTACCA
CAAAAAACTGAAAAAATAGGGCTTGCAGCCTAAGCTGTAAATCAAAGCTCTAACGTACGT
TCTAATTTTACACCTCCTACAATAGTCAATAGAAATAATTGGACAAATAATTTATCCAAT
GGGCCAGGTAGTGCACTCACTGCATCTTCTACTGCAAAAAAGCAAGCTGACATAAAGGAT
GTTGATTATTCAACCTTAGATTATTTGAATTAACCAGAAAGACCATTTGTTCCTCTTGAA
TCTAAAAATAAAGGAAAACATGTCTCTAAAAGTAACTAATACTACACAGTTGCAGATATT
AATGAATATGCAATAAAACCACATCCTTGGGATCAGAAGGTTAATGATATATTAGCTAAC
GTCTATGGCTATAAAAATTTTAGAAATAATTAAAGAGCAATTATAAATTGTGTCTTGGAG
AATAAAGATGTGTTTGCAATGATGCCCACTGGAGGTGGCAAATCTCTTACATTTTAAATA
CCTGGACTTGTCTAAGATGGAGTTTATATTGTTATTATGCCTCTTATTTCACTTATTTCT
GATTAATACAATCACATGCTTAGGCTCAATATTCCAGTTATCAGAGTTTAAGGAGCTAGG
AAGAACTACTAAAGAGAATTAGATTCAATACTTTATTCAGATAAGAATTAGTCTAAAATT
GTGTTAATCACACCAGAAAAAATATCATCAGATGAAGATTTTAACCAATTTTTAAGCTAA
ATTTATGAAAAAAATAAATTGAGAAGATTTGTTATTGATGAAGCTCACTGTGTTTCTTAA
TGGGGACACGAGTTTAGAAAAGATTATCTTTCTTTAGGATAGTTAAAAATAAAATATCCA
AACATTCCTACACTTGCTCTAACTGCTACAGCTACTGAAAAGTGCAAAATAGATATTATT
TAACTTCTTAATATGAAAGGAACTCTGTATTTTTAATCTTCTTTTAATCGTACAAATCTT
TACTACGATGTAGTAAGGATACCCTAAAAAGTAACAATCGAGCATATGGTTAATTTTATC
AAAGAAAAGTTTAATAAGCAAAGTGGTATTATATATTGCTGCACAAAAAAAGACTCAGAA
GAATTAGCTAGTAAGCTAAATATATAATATAAAATTAATGCAGCATATTATCACGGATCT
ATGAATGACAAAGAAAAAGAATAAGTTCAATAACTTTGGATGTCAAATGATATTTAAGTA
ATATGTGCCACAATAGCTTTTGGTATGGGTATCGACAAGCATGATGTCAGATTTGTCATC
CATTATACTTTTTCTAAATCTATCGAAAATTACTATTAAGAAGCAGGTAGAGCAGGAAGA
GATGGTAAAATATCTCACTGCAGAATTTACTACTCTCCAAAAGATAAAAATTCTTTAGTC
TTTTTGATCACTAATAATGAAGGCAGCAATAAATAGAAAAAAGAAGAATGCATGGCTCAT
TTAAGTAAAATGATAAGATATTGCGAAGATACAATTAATTGTAGAAGGGTTTTGCAATTA
GCACACTTGGGTGAAAAATTTGAACCTAAATTTTGCAATAAAATGTGCGATAACTGCAGA
AATTAAACTTCTAAAAGCAATATAATACAAAAAGATTTTACTTAAGATTGCAAAAATATA
CTATAAGAATATTTGAGTATGTATAATAAAAACATACAGCTGACTTAAAAGCAATTAGTA
GACGTTCTCAGAGGTAAAAAACTACAAAAAAAGGCAGGTTAAAACCTACTTAAAATGATT
GAAAACAGCTCAATCTATAGTCTATTAAAGAATTATGATTAATTAACTGTTGAAAATATT
GTTAAAGAAATGATGTCTTAGGGTTATTTGAGTGAAAAAATTAAAAAGTTTCGTGCTTAT
ACTTAAGTATTTCTTGAAGTAGTTAAGTCTAAGTATAATGAGTTATGTAATCCAAACAAA
ATGACTGACAAAATCATGATCAATTAAGTAGTTTCTCAAAGCTCTAAATCAAAAGTAGAT
AGTCAATTTTTATTTGACAAAGAATTAATTGATGATATTACAGAATCAGATTTACCTAAA
GAGTAAGAATTTTTTGATTAAAATAAAAATCTCATTTTTGATGATGAAGAATCACTATCT
TAAATGTCTGAAGGTGATTTAATAGATTTAATTGATCTTGCAAATAAGAATAAAACTTCT
TGCAACCAAAATGATTCGTCAGATAACATGTAAGAACTAAATAAATAGTATAGCGAAGAT
GATTCAGACTTTTAATTTTAAATACCTTCTGAGAGAAACTAATAAAGTAGAAGTGGGATT
ATTTATGAAGAAAATGATGAATAAAATTAAATTGGTCAAGCATATAGTGAGGATTATAAC
AGTCAAAATAAATAAGCTAATGAAAAACTAAACTAAGAACAGATATAAATTGAAGAGGAT
GATGATGACGATGATGACGACGATGATGATATTTTACAAATAGCAGCTAAAACAAATCTT
TTAGAATAAATAAAAAAATAAAACACGATGAGTGTAGAAAAATAAAATAGTTTGAAAGAA
AATTATCTTTATAAATCTCCTCAAGAATAAGATAATTTCTTTTCTGAATTTAAATTAGGC
AATAATAACAATAAACCTTAAACTTCTTTAGGATAAACAGGTCATAAGCCACCTTAATAA
AACAATTAAAATATGAGCTCATTGAATAATTTTAAATTTTCTACAGGAAACAATAAATTA
AAATAAGACTAAGCTGATCTTTTTTCATTTAACTTTCAAAAACTTGCAAAAAATTGA


>TTHERM_01030000(protein)
MDEILQQFIDSKRQAKKIEDFADAVSCSATESLEDQDQSFDRGADFNDGEVDDALLDELI
EYQTNRERQSITEEQNDLMKTELQKPISNNLNKKQPTSLSGLQKGLGNKISGPSYDFSNS
NNMQTLSGIYSSNSNNNSQNSNENFNFNRQGNTTLKPTGFDAIKLKKNQNQDQQQQQQQQ
QVLKFVNQNSNGGIQVEASLTDKRRQVNNSNDIDSFMLINNGQKEKKTKNQNSKISELLE
KYKVIDSNSNTQNFESTSLNTSLNTKNNKLEVKNGFQNLPQKTEKIGLAAQAVNQSSNVR
SNFTPPTIVNRNNWTNNLSNGPGSALTASSTAKKQADIKDVDYSTLDYLNQPERPFVPLE
SKNKGKHVSKSNQYYTVADINEYAIKPHPWDQKVNDILANVYGYKNFRNNQRAIINCVLE
NKDVFAMMPTGGGKSLTFQIPGLVQDGVYIVIMPLISLISDQYNHMLRLNIPVIRVQGAR
KNYQRELDSILYSDKNQSKIVLITPEKISSDEDFNQFLSQIYEKNKLRRFVIDEAHCVSQ
WGHEFRKDYLSLGQLKIKYPNIPTLALTATATEKCKIDIIQLLNMKGTLYFQSSFNRTNL
YYDVVRIPQKVTIEHMVNFIKEKFNKQSGIIYCCTKKDSEELASKLNIQYKINAAYYHGS
MNDKEKEQVQQLWMSNDIQVICATIAFGMGIDKHDVRFVIHYTFSKSIENYYQEAGRAGR
DGKISHCRIYYSPKDKNSLVFLITNNEGSNKQKKEECMAHLSKMIRYCEDTINCRRVLQL
AHLGEKFEPKFCNKMCDNCRNQTSKSNIIQKDFTQDCKNILQEYLSMYNKNIQLTQKQLV
DVLRGKKLQKKAGQNLLKMIENSSIYSLLKNYDQLTVENIVKEMMSQGYLSEKIKKFRAY
TQVFLEVVKSKYNELCNPNKMTDKIMINQVVSQSSKSKVDSQFLFDKELIDDITESDLPK
EQEFFDQNKNLIFDDEESLSQMSEGDLIDLIDLANKNKTSCNQNDSSDNMQELNKQYSED
DSDFQFQIPSERNQQSRSGIIYEENDEQNQIGQAYSEDYNSQNKQANEKLNQEQIQIEED
DDDDDDDDDDILQIAAKTNLLEQIKKQNTMSVEKQNSLKENYLYKSPQEQDNFFSEFKLG
NNNNKPQTSLGQTGHKPPQQNNQNMSSLNNFKFSTGNNKLKQDQADLFSFNFQKLAKN


>TTHERM_01030000(gene)
ATGGATGAAATATTGTAGTAATTTATAGATAGCAAAAGATAAGCAAAGAAGATAGAAGAT
TTTGCAGACGCTGTATCATGCAGTGCCACAGAAAGCTTAGAAGATTAGGACTAATCTTTT
GATAGAGGTGCTGATTTCAACGATGGAGAAGTAGATGATGCTTTATTGGATGAACTTATA
GAATATTAAACAAACAGAGAGCGTTAATCAATTACTGAAGAGTAAAATGATCTCATGAAA
ACTGAATTGTAAAAGCCAATAAGCAACAATTTAAATAAAAAATAACCAACTAGCTTGAGC
GGTTTGCAAAAAGGGTTAGGAAACAAAATATCTGGACCTTCTTATGATTTTAGTAACTCT
AATAATATGTAGACATTAAGCGGCATTTATAGTTCAAATTCTAACAATAACTCTTAGAAC
AGCAATGAGAACTTTAATGTAAAATATTTTATAAAAATCAAAATTAATTTAAATGCATAA
AAATAAAATAAAAAAGTTCAATAGACAAGGAAATACTACTCTAAAGCCTACGGGTTTTGA
TGCTATCAAGCTTAAAAAAAATTAGAATTAAGATTAATAGTAATAATAATAGCAATAGCA
AGTTCTGAAATTTGTAAATTAAAATAGTAATGGAGGGATTTAAGTAGAGGCTTCTTTAAC
AGATAAAAGAAGATAAGTAAATAACTCTAATGATATTGATAGTTTCATGTTGATCAATAA
CGGATAAAAAGAAAAAAAGACAAAAAATTAAAATTCTAAAATAAGTGAGTTGCTTGAGAA
GTACAAAGTGATAGATTCTAATTCAAATACTTAAAATTTCGAGTCTACTTCGCTTAATAC
TTCTCTCAATACCAAAAATAATAAATTAGAAGTTAAAAATGGGTTTTAAAATTTACCACA
AAAAACTGAAAAAATAGGGCTTGCAGCCTAAGCTGTAAATCAAAGCTCTAACGTACGTTC
TAATTTTACACCTCCTACAATAGTCAATAGAAATAATTGGACAAATAATTTATCCAATGG
GCCAGGTAGTGCACTCACTGCATCTTCTACTGCAAAAAAGCAAGCTGACATAAAGGATGT
TGATTATTCAACCTTAGATTATTTGAATTAACCAGAAAGACCATTTGTTCCTCTTGAATC
TAAAAATAAAGGAAAACATGTCTCTAAAAGTAACTAATACTACACAGTTGCAGATATTAA
TGAATATGTAAAATAATTTATTACAATTTCAGAAAAAAATTAACATTATTCTAATTAATT
CGATGAAGAAATAATTAAATTTATTTATTTTAATATTTTAATATTTTCTTTTTCCTCATC
AAAGAAAATTAAAAATATTTATTGATTAAAATGATTTATTTAATTTTCAAATATAAAAGG
CAATAAAACCACATCCTTGGGATCAGAAGGTTAATGATATATTAGCTAACGTCTATGGCT
ATAAAAATTTTAGAAATAATTAAAGAGCAATTATAAATTGTGTCTTGGAGAATAAAGATG
TGTTTGCAATGATGCCCACTGGAGGTGGCAAATCTCTTACATTTTAAATACCTGGACTTG
TCTAAGATGGAGTTTATATTGTTATTATGCCTCTTATTTCACTTATTTCTGATTAATACA
ATCACATGCTTAGGCTCAATATTCCAGTTATCAGAGTTTAAGGAGCTAGGAAGAACTACT
AAAGAGAATTAGATTCAATACTTTATTCAGATAAGAATTAGTCTAAAATTGTGTTAATCA
CACCAGAAAAAATATCATCAGATGAAGATTTTAACCAATTTTTAAGCTAAATTTATGAAA
AAAATAAATTGAGAAGATTTGTTATTGATGAAGCTCACTGTGTTTCTTAATGGGGACACG
AGTTTAGAAAAGATTATCTTTCTTTAGGATAGTTAAAAATAAAATATCCAAACATTCCTA
CACTTGCTCTAACTGCTACAGCTACTGAAAAGTGCAAAATAGATATTATTTAACTTCTTA
ATATGAAAGGAACTCTGTATTTTTAATCTTCTTTTAATCGTACAAATCTTTACTACGATG
TAGTAAGGATACCCTAAAAAGTAACAATCGAGCATATGGTTAATTTTATCAAAGGTAAAT
AAATCATAATTATTATTTTTCTTTATTTTAGCTAAAAAATTTTACTATTTTACAGAAAAG
TTTAATAAGCAAAGTGGTATTATATATTGCTGCACAAAAAAAGACTCAGAAGAATTAGCT
AGTAAGCTAAATATATAATATAAAATTAATGCAGCATATTATCACGGATCTATGAATGAC
AAAGAAAAAGAATAAGTTCAATAACTTTGGATGTCAAATGATATTTAAGTAATATGTGCC
ACAATAGGTAATAAAATTAGAAATAATTTAATTTGATTATTAAAAATTTTCAAATATATA
TAGCTTTTGGTATGGGTATCGACAAGCATGATGTCAGATTTGTCATCCATTATACTTTTT
CTAAATCTATCGAAAATTACTATTAAGAAGCAGGTAGAGCAGGAAGAGATGGTAAAATAT
CTCACTGCAGAATTTACTACTCTCCAAAAGATAAAAATTCTTTAGTCTTTTTGATCACTA
ATAATGAAGGCAGCAATAAATAGAAAAAAGAAGAATGCATGGCTCATTTAAGTAAAATGA
TAAGGTAAAATCTCTTTTATAACCAAAACCAATATTTATTAAATATTTAAGAATTAATTT
TACATATATATTTATTTTTTAAATTAAAAGTTTAAAATTAAATTTAGTAATTATTAAGTT
TTACAATATATATTGAATATTTATATATAGATATTGCGAAGATACAATTAATTGTAGAAG
GGTTTTGCAATTAGCACACTTGGGTGAAAAATTTGAACCTAAATTTTGCAATAAAATGTG
CGATAACTGCAGAAATTAAACTTCTAAAAGCAATATAATACAAAAAGATTTTACTTAAGA
TTGCAAAAATATACTATAAGAATATTTGAGTATGTATAATAAAAACATACAGCTGACTTA
AAAGCAATTAGTAGACGTTCTCAGAGGTAAAAAACTACAAAAAAAGGCAGGTTAAAACCT
ACTTAAAATGATTGAAAACAGCTCAATCTATAGTCTATTAAAGAATTATGATTAATTAAC
TGTTGAAAATATTGTTAAAGAAATGATGTCTTAGGGTTATTTGAGTGAAAAAATTAAAAA
GTTTCGTGCTTATACTTAAGTATTTCTTGAAGTAGTTAAGTCTAAGTATAATGAGTTATG
TAATCCAAACAAAATGACTGACAAAATCATGATCAATTAAGTAGTTTCTCAAAGCTCTAA
ATCAAAAGTAGATAGTCAATTTTTATTTGACAAAGAATTAATTGATGATATTACAGAATC
AGATTTACCTAAAGAGTAAGAATTTTTTGATTAAAATAAAAATCTCATTTTTGATGATGA
AGAATCACTATCTTAAATGTCTGAAGGTGATTTAATAGATTTAATTGATCTTGCAAATAA
GAATAAAACTTCTTGCAACCAAAATGATTCGTCAGATAACATGTAAGAACTAAATAAATA
GTATAGCGAAGATGATTCAGACTTTTAATTTTAAATACCTTCTGAGAGAAACTAATAAAG
TAGAAGTGGGATTATTTATGAAGAAAATGATGAATAAAATTAAATTGGTCAAGCATATAG
TGAGGATTATAACAGTCAAAATAAATAAGCTAATGAAAAACTAAACTAAGAACAGATATA
AATTGAAGAGGATGATGATGACGATGATGACGACGATGATGATATTTTACAAATAGCAGC
TAAAACAAATCTTTTAGAATAAATAAAAAAATAAAACACGATGAGTGTAGAAAAATAAAA
TAGTTTGAAAGAAAATTATCTTTATAAATCTCCTCAAGAATAAGATAATTTCTTTTCTGA
ATTTAAATTAGGCAATAATAACAATAAACCTTAAACTTCTTTAGGATAAACAGGTCATAA
GCCACCTTAATAAAACAATTAAAATATGAGCTCATTGAATAATTTTAAATTTTCTACAGG
AAACAATAAATTAAAATAAGACTAAGCTGATCTTTTTTCATTTAACTTTCAAAAACTTGC
AAAAAATTGA