Identifiers and Description

Gene Model Identifier

TTHERM_01030000

Standard Name

SGS1 (Homolog of budding yeast Sgs1 and fission yeast rqh1)

Aliases

PreTt10830 | 204.m00059

Description

ATP-dependent DNA helicase, RecQ family protein Protein involved in DNA joint molecule resolution dHJ dissolution and crossing over

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF01202 ) shikimate kinase
  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF08839 ) DNA replication factor CDT1 like
  • ( TIGR00643 ) ATP-dependent DNA helicase RecG
  • ( TIGR01389 ) ATP-dependent DNA helicase RecQ
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( PF06827 ) Zinc finger found in FPG
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( TIGR03158 ) CRISPR-associated helicase, Cyano-type
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01030000

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10497.19.997093137033517e-262ATP-dependent DNA helicase, Re
cQ family protein (1193 aa)
OxytrichaContig17511.0.g631.999149254372995e-126DEAD/DEAH box helicase
DictyBaseDDB_G02921301.9992982665753866e-121blm on chromosome: 6 position
1240457 to 1244236
SGDYMR190C1.0002857351297358e-115SGS1 Nucleolar DNA helicase of
the RecQ family; involved in
genome integrity maintenance;
regulates chromosome synapsis
and meiotic joint molecule/cro
ssover formation; potential ro
le as repressor of a subset of
rapamycin responsive genes; r
apidly lost in response to rap
amycin in Rrd1p-dependent mann
er; similar to human BLM and W
RN proteins implicated in Bloo
m and Werner syndromes
WormBaseWBGene000193342.999180586171967e-98Putative ATP-dependent DNA hel
icase Q1 status:Confirmed
UniProt:Q9TXJ8 protein_id:CC
D61880.1
Stentor CoeruleusSteCoe_287672.572209372642415e-56

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:26519827: Lukaszewicz A, Shodhan A, Loidl J (2015) Exo1 and Mre11 execute meiotic DSB end resection in the protist Tetrahymena. DNA repair 35( ):137-43
  2. Ref:23935123: Lukaszewicz A, Howard-Till RA, Loidl J (2013) Mus81 nuclease and Sgs1 helicase are essential for meiotic recombination in a protist lacking a synaptonemal complex. Nucleic acids research 41(20):9296-309

Sequences

>TTHERM_01030000(coding)
ATGGATGAAATATTGTAGTAATTTATAGATAGCAAAAGATAAGCAAAGAAGATAGAAGAT
TTTGCAGACGCTGTATCATGCAGTGCCACAGAAAGCTTAGAAGATTAGGACTAATCTTTT
GATAGAGGTGCTGATTTCAACGATGGAGAAGTAGATGATGCTTTATTGGATGAACTTATA
GAATATTAAACAAACAGAGAGCGTTAATCAATTACTGAAGAGTAAAATGATCTCATGAAA
ACTGAATTGTAAAAGCCAATAAGCAACAATTTAAATAAAAAATAACCAACTAGCTTGAGC
GGTTTGCAAAAAGGGTTAGGAAACAAAATATCTGGACCTTCTTATGATTTTAGTAACTCT
AATAATATGTAGACATTAAGCGGCATTTATAGTTCAAATTCTAACAATAACTCTTAGAAC
AGCAATGAGAACTTTAATTTCAATAGACAAGGAAATACTACTCTAAAGCCTACGGGTTTT
GATGCTATCAAGCTTAAAAAAAATTAGAATTAAGATTAATAGTAATAATAATAGCAATAG
CAAGTTCTGAAATTTGTAAATTAAAATAGTAATGGAGGGATTTAAGTAGAGGCTTCTTTA
ACAGATAAAAGAAGATAAGTAAATAACTCTAATGATATTGATAGTTTCATGTTGATCAAT
AACGGATAAAAAGAAAAAAAGACAAAAAATTAAAATTCTAAAATAAGTGAGTTGCTTGAG
AAGTACAAAGTGATAGATTCTAATTCAAATACTTAAAATTTCGAGTCTACTTCGCTTAAT
ACTTCTCTCAATACCAAAAATAATAAATTAGAAGTTAAAAATGGGTTTTAAAATTTACCA
CAAAAAACTGAAAAAATAGGGCTTGCAGCCTAAGCTGTAAATCAAAGCTCTAACGTACGT
TCTAATTTTACACCTCCTACAATAGTCAATAGAAATAATTGGACAAATAATTTATCCAAT
GGGCCAGGTAGTGCACTCACTGCATCTTCTACTGCAAAAAAGCAAGCTGACATAAAGGAT
GTTGATTATTCAACCTTAGATTATTTGAATTAACCAGAAAGACCATTTGTTCCTCTTGAA
TCTAAAAATAAAGGAAAACATGTCTCTAAAAGTAACTAATACTACACAGTTGCAGATATT
AATGAATATGCAATAAAACCACATCCTTGGGATCAGAAGGTTAATGATATATTAGCTAAC
GTCTATGGCTATAAAAATTTTAGAAATAATTAAAGAGCAATTATAAATTGTGTCTTGGAG
AATAAAGATGTGTTTGCAATGATGCCCACTGGAGGTGGCAAATCTCTTACATTTTAAATA
CCTGGACTTGTCTAAGATGGAGTTTATATTGTTATTATGCCTCTTATTTCACTTATTTCT
GATTAATACAATCACATGCTTAGGCTCAATATTCCAGTTATCAGAGTTTAAGGAGCTAGG
AAGAACTACTAAAGAGAATTAGATTCAATACTTTATTCAGATAAGAATTAGTCTAAAATT
GTGTTAATCACACCAGAAAAAATATCATCAGATGAAGATTTTAACCAATTTTTAAGCTAA
ATTTATGAAAAAAATAAATTGAGAAGATTTGTTATTGATGAAGCTCACTGTGTTTCTTAA
TGGGGACACGAGTTTAGAAAAGATTATCTTTCTTTAGGATAGTTAAAAATAAAATATCCA
AACATTCCTACACTTGCTCTAACTGCTACAGCTACTGAAAAGTGCAAAATAGATATTATT
TAACTTCTTAATATGAAAGGAACTCTGTATTTTTAATCTTCTTTTAATCGTACAAATCTT
TACTACGATGTAGTAAGGATACCCTAAAAAGTAACAATCGAGCATATGGTTAATTTTATC
AAAGAAAAGTTTAATAAGCAAAGTGGTATTATATATTGCTGCACAAAAAAAGACTCAGAA
GAATTAGCTAGTAAGCTAAATATATAATATAAAATTAATGCAGCATATTATCACGGATCT
ATGAATGACAAAGAAAAAGAATAAGTTCAATAACTTTGGATGTCAAATGATATTTAAGTA
ATATGTGCCACAATAGCTTTTGGTATGGGTATCGACAAGCATGATGTCAGATTTGTCATC
CATTATACTTTTTCTAAATCTATCGAAAATTACTATTAAGAAGCAGGTAGAGCAGGAAGA
GATGGTAAAATATCTCACTGCAGAATTTACTACTCTCCAAAAGATAAAAATTCTTTAGTC
TTTTTGATCACTAATAATGAAGGCAGCAATAAATAGAAAAAAGAAGAATGCATGGCTCAT
TTAAGTAAAATGATAAGATATTGCGAAGATACAATTAATTGTAGAAGGGTTTTGCAATTA
GCACACTTGGGTGAAAAATTTGAACCTAAATTTTGCAATAAAATGTGCGATAACTGCAGA
AATTAAACTTCTAAAAGCAATATAATACAAAAAGATTTTACTTAAGATTGCAAAAATATA
CTATAAGAATATTTGAGTATGTATAATAAAAACATACAGCTGACTTAAAAGCAATTAGTA
GACGTTCTCAGAGGTAAAAAACTACAAAAAAAGGCAGGTTAAAACCTACTTAAAATGATT
GAAAACAGCTCAATCTATAGTCTATTAAAGAATTATGATTAATTAACTGTTGAAAATATT
GTTAAAGAAATGATGTCTTAGGGTTATTTGAGTGAAAAAATTAAAAAGTTTCGTGCTTAT
ACTTAAGTATTTCTTGAAGTAGTTAAGTCTAAGTATAATGAGTTATGTAATCCAAACAAA
ATGACTGACAAAATCATGATCAATTAAGTAGTTTCTCAAAGCTCTAAATCAAAAGTAGAT
AGTCAATTTTTATTTGACAAAGAATTAATTGATGATATTACAGAATCAGATTTACCTAAA
GAGTAAGAATTTTTTGATTAAAATAAAAATCTCATTTTTGATGATGAAGAATCACTATCT
TAAATGTCTGAAGGTGATTTAATAGATTTAATTGATCTTGCAAATAAGAATAAAACTTCT
TGCAACCAAAATGATTCGTCAGATAACATGTAAGAACTAAATAAATAGTATAGCGAAGAT
GATTCAGACTTTTAATTTTAAATACCTTCTGAGAGAAACTAATAAAGTAGAAGTGGGATT
ATTTATGAAGAAAATGATGAATAAAATTAAATTGGTCAAGCATATAGTGAGGATTATAAC
AGTCAAAATAAATAAGCTAATGAAAAACTAAACTAAGAACAGATATAAATTGAAGAGGAT
GATGATGACGATGATGACGACGATGATGATATTTTACAAATAGCAGCTAAAACAAATCTT
TTAGAATAAATAAAAAAATAAAACACGATGAGTGTAGAAAAATAAAATAGTTTGAAAGAA
AATTATCTTTATAAATCTCCTCAAGAATAAGATAATTTCTTTTCTGAATTTAAATTAGGC
AATAATAACAATAAACCTTAAACTTCTTTAGGATAAACAGGTCATAAGCCACCTTAATAA
AACAATTAAAATATGAGCTCATTGAATAATTTTAAATTTTCTACAGGAAACAATAAATTA
AAATAAGACTAAGCTGATCTTTTTTCATTTAACTTTCAAAAACTTGCAAAAAATTGA


>TTHERM_01030000(protein)
MDEILQQFIDSKRQAKKIEDFADAVSCSATESLEDQDQSFDRGADFNDGEVDDALLDELI
EYQTNRERQSITEEQNDLMKTELQKPISNNLNKKQPTSLSGLQKGLGNKISGPSYDFSNS
NNMQTLSGIYSSNSNNNSQNSNENFNFNRQGNTTLKPTGFDAIKLKKNQNQDQQQQQQQQ
QVLKFVNQNSNGGIQVEASLTDKRRQVNNSNDIDSFMLINNGQKEKKTKNQNSKISELLE
KYKVIDSNSNTQNFESTSLNTSLNTKNNKLEVKNGFQNLPQKTEKIGLAAQAVNQSSNVR
SNFTPPTIVNRNNWTNNLSNGPGSALTASSTAKKQADIKDVDYSTLDYLNQPERPFVPLE
SKNKGKHVSKSNQYYTVADINEYAIKPHPWDQKVNDILANVYGYKNFRNNQRAIINCVLE
NKDVFAMMPTGGGKSLTFQIPGLVQDGVYIVIMPLISLISDQYNHMLRLNIPVIRVQGAR
KNYQRELDSILYSDKNQSKIVLITPEKISSDEDFNQFLSQIYEKNKLRRFVIDEAHCVSQ
WGHEFRKDYLSLGQLKIKYPNIPTLALTATATEKCKIDIIQLLNMKGTLYFQSSFNRTNL
YYDVVRIPQKVTIEHMVNFIKEKFNKQSGIIYCCTKKDSEELASKLNIQYKINAAYYHGS
MNDKEKEQVQQLWMSNDIQVICATIAFGMGIDKHDVRFVIHYTFSKSIENYYQEAGRAGR
DGKISHCRIYYSPKDKNSLVFLITNNEGSNKQKKEECMAHLSKMIRYCEDTINCRRVLQL
AHLGEKFEPKFCNKMCDNCRNQTSKSNIIQKDFTQDCKNILQEYLSMYNKNIQLTQKQLV
DVLRGKKLQKKAGQNLLKMIENSSIYSLLKNYDQLTVENIVKEMMSQGYLSEKIKKFRAY
TQVFLEVVKSKYNELCNPNKMTDKIMINQVVSQSSKSKVDSQFLFDKELIDDITESDLPK
EQEFFDQNKNLIFDDEESLSQMSEGDLIDLIDLANKNKTSCNQNDSSDNMQELNKQYSED
DSDFQFQIPSERNQQSRSGIIYEENDEQNQIGQAYSEDYNSQNKQANEKLNQEQIQIEED
DDDDDDDDDDILQIAAKTNLLEQIKKQNTMSVEKQNSLKENYLYKSPQEQDNFFSEFKLG
NNNNKPQTSLGQTGHKPPQQNNQNMSSLNNFKFSTGNNKLKQDQADLFSFNFQKLAKN


>TTHERM_01030000(gene)
ATGGATGAAATATTGTAGTAATTTATAGATAGCAAAAGATAAGCAAAGAAGATAGAAGAT
TTTGCAGACGCTGTATCATGCAGTGCCACAGAAAGCTTAGAAGATTAGGACTAATCTTTT
GATAGAGGTGCTGATTTCAACGATGGAGAAGTAGATGATGCTTTATTGGATGAACTTATA
GAATATTAAACAAACAGAGAGCGTTAATCAATTACTGAAGAGTAAAATGATCTCATGAAA
ACTGAATTGTAAAAGCCAATAAGCAACAATTTAAATAAAAAATAACCAACTAGCTTGAGC
GGTTTGCAAAAAGGGTTAGGAAACAAAATATCTGGACCTTCTTATGATTTTAGTAACTCT
AATAATATGTAGACATTAAGCGGCATTTATAGTTCAAATTCTAACAATAACTCTTAGAAC
AGCAATGAGAACTTTAATGTAAAATATTTTATAAAAATCAAAATTAATTTAAATGCATAA
AAATAAAATAAAAAAGTTCAATAGACAAGGAAATACTACTCTAAAGCCTACGGGTTTTGA
TGCTATCAAGCTTAAAAAAAATTAGAATTAAGATTAATAGTAATAATAATAGCAATAGCA
AGTTCTGAAATTTGTAAATTAAAATAGTAATGGAGGGATTTAAGTAGAGGCTTCTTTAAC
AGATAAAAGAAGATAAGTAAATAACTCTAATGATATTGATAGTTTCATGTTGATCAATAA
CGGATAAAAAGAAAAAAAGACAAAAAATTAAAATTCTAAAATAAGTGAGTTGCTTGAGAA
GTACAAAGTGATAGATTCTAATTCAAATACTTAAAATTTCGAGTCTACTTCGCTTAATAC
TTCTCTCAATACCAAAAATAATAAATTAGAAGTTAAAAATGGGTTTTAAAATTTACCACA
AAAAACTGAAAAAATAGGGCTTGCAGCCTAAGCTGTAAATCAAAGCTCTAACGTACGTTC
TAATTTTACACCTCCTACAATAGTCAATAGAAATAATTGGACAAATAATTTATCCAATGG
GCCAGGTAGTGCACTCACTGCATCTTCTACTGCAAAAAAGCAAGCTGACATAAAGGATGT
TGATTATTCAACCTTAGATTATTTGAATTAACCAGAAAGACCATTTGTTCCTCTTGAATC
TAAAAATAAAGGAAAACATGTCTCTAAAAGTAACTAATACTACACAGTTGCAGATATTAA
TGAATATGTAAAATAATTTATTACAATTTCAGAAAAAAATTAACATTATTCTAATTAATT
CGATGAAGAAATAATTAAATTTATTTATTTTAATATTTTAATATTTTCTTTTTCCTCATC
AAAGAAAATTAAAAATATTTATTGATTAAAATGATTTATTTAATTTTCAAATATAAAAGG
CAATAAAACCACATCCTTGGGATCAGAAGGTTAATGATATATTAGCTAACGTCTATGGCT
ATAAAAATTTTAGAAATAATTAAAGAGCAATTATAAATTGTGTCTTGGAGAATAAAGATG
TGTTTGCAATGATGCCCACTGGAGGTGGCAAATCTCTTACATTTTAAATACCTGGACTTG
TCTAAGATGGAGTTTATATTGTTATTATGCCTCTTATTTCACTTATTTCTGATTAATACA
ATCACATGCTTAGGCTCAATATTCCAGTTATCAGAGTTTAAGGAGCTAGGAAGAACTACT
AAAGAGAATTAGATTCAATACTTTATTCAGATAAGAATTAGTCTAAAATTGTGTTAATCA
CACCAGAAAAAATATCATCAGATGAAGATTTTAACCAATTTTTAAGCTAAATTTATGAAA
AAAATAAATTGAGAAGATTTGTTATTGATGAAGCTCACTGTGTTTCTTAATGGGGACACG
AGTTTAGAAAAGATTATCTTTCTTTAGGATAGTTAAAAATAAAATATCCAAACATTCCTA
CACTTGCTCTAACTGCTACAGCTACTGAAAAGTGCAAAATAGATATTATTTAACTTCTTA
ATATGAAAGGAACTCTGTATTTTTAATCTTCTTTTAATCGTACAAATCTTTACTACGATG
TAGTAAGGATACCCTAAAAAGTAACAATCGAGCATATGGTTAATTTTATCAAAGGTAAAT
AAATCATAATTATTATTTTTCTTTATTTTAGCTAAAAAATTTTACTATTTTACAGAAAAG
TTTAATAAGCAAAGTGGTATTATATATTGCTGCACAAAAAAAGACTCAGAAGAATTAGCT
AGTAAGCTAAATATATAATATAAAATTAATGCAGCATATTATCACGGATCTATGAATGAC
AAAGAAAAAGAATAAGTTCAATAACTTTGGATGTCAAATGATATTTAAGTAATATGTGCC
ACAATAGGTAATAAAATTAGAAATAATTTAATTTGATTATTAAAAATTTTCAAATATATA
TAGCTTTTGGTATGGGTATCGACAAGCATGATGTCAGATTTGTCATCCATTATACTTTTT
CTAAATCTATCGAAAATTACTATTAAGAAGCAGGTAGAGCAGGAAGAGATGGTAAAATAT
CTCACTGCAGAATTTACTACTCTCCAAAAGATAAAAATTCTTTAGTCTTTTTGATCACTA
ATAATGAAGGCAGCAATAAATAGAAAAAAGAAGAATGCATGGCTCATTTAAGTAAAATGA
TAAGGTAAAATCTCTTTTATAACCAAAACCAATATTTATTAAATATTTAAGAATTAATTT
TACATATATATTTATTTTTTAAATTAAAAGTTTAAAATTAAATTTAGTAATTATTAAGTT
TTACAATATATATTGAATATTTATATATAGATATTGCGAAGATACAATTAATTGTAGAAG
GGTTTTGCAATTAGCACACTTGGGTGAAAAATTTGAACCTAAATTTTGCAATAAAATGTG
CGATAACTGCAGAAATTAAACTTCTAAAAGCAATATAATACAAAAAGATTTTACTTAAGA
TTGCAAAAATATACTATAAGAATATTTGAGTATGTATAATAAAAACATACAGCTGACTTA
AAAGCAATTAGTAGACGTTCTCAGAGGTAAAAAACTACAAAAAAAGGCAGGTTAAAACCT
ACTTAAAATGATTGAAAACAGCTCAATCTATAGTCTATTAAAGAATTATGATTAATTAAC
TGTTGAAAATATTGTTAAAGAAATGATGTCTTAGGGTTATTTGAGTGAAAAAATTAAAAA
GTTTCGTGCTTATACTTAAGTATTTCTTGAAGTAGTTAAGTCTAAGTATAATGAGTTATG
TAATCCAAACAAAATGACTGACAAAATCATGATCAATTAAGTAGTTTCTCAAAGCTCTAA
ATCAAAAGTAGATAGTCAATTTTTATTTGACAAAGAATTAATTGATGATATTACAGAATC
AGATTTACCTAAAGAGTAAGAATTTTTTGATTAAAATAAAAATCTCATTTTTGATGATGA
AGAATCACTATCTTAAATGTCTGAAGGTGATTTAATAGATTTAATTGATCTTGCAAATAA
GAATAAAACTTCTTGCAACCAAAATGATTCGTCAGATAACATGTAAGAACTAAATAAATA
GTATAGCGAAGATGATTCAGACTTTTAATTTTAAATACCTTCTGAGAGAAACTAATAAAG
TAGAAGTGGGATTATTTATGAAGAAAATGATGAATAAAATTAAATTGGTCAAGCATATAG
TGAGGATTATAACAGTCAAAATAAATAAGCTAATGAAAAACTAAACTAAGAACAGATATA
AATTGAAGAGGATGATGATGACGATGATGACGACGATGATGATATTTTACAAATAGCAGC
TAAAACAAATCTTTTAGAATAAATAAAAAAATAAAACACGATGAGTGTAGAAAAATAAAA
TAGTTTGAAAGAAAATTATCTTTATAAATCTCCTCAAGAATAAGATAATTTCTTTTCTGA
ATTTAAATTAGGCAATAATAACAATAAACCTTAAACTTCTTTAGGATAAACAGGTCATAA
GCCACCTTAATAAAACAATTAAAATATGAGCTCATTGAATAATTTTAAATTTTCTACAGG
AAACAATAAATTAAAATAAGACTAAGCTGATCTTTTTTCATTTAACTTTCAAAAACTTGC
AAAAAATTGA