Identifiers and Description

Gene Model Identifier

TTHERM_00997760

Standard Name

SFR9 (Sfi1 repeat protein)

Aliases

PreTt25001 | 188.m00077

Description

cortical row basal body localization; predicted to have 19 Sfi1 repeats; Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF04335 ) VirB8 protein
  • ( PF00560 ) Leucine Rich Repeat
  • ( PF08828 ) Doublesex dimerisation domain
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( PF00242 ) DNA polymerase (viral) N-terminal domain
  • ( PF05278 ) Arabidopsis phospholipase-like protein (PEARLI 4)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00997760

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20925.19.997093137033517e-262hypothetical protein (1092 aa)
OxytrichaContig4888.0.g900.000000004999139696582238Leucine Rich repeats (2 copies
)
Stentor CoeruleusSteCoe_315350.00000011253517471925912

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00997760(coding)
ATGAAAAAGGGATAACGCTTAAAAGAATATAAACTATCTGAAGCACTTAAATCATTTCCT
TAGAAAGATTCTAATTTAATAAATCTATCTTTCAAAAACATATCTGTTATTGATAATGTA
CCAAAGAAATATCATGCTGTAGAATCTTTAGACTTAAGGGGAAACATTTTAACTTCTATT
AAAGGAGTTACATAATTTTAAAAGCTTGTTCATTTAAATCTGGCAACCAACAATATTCTT
AATCTTGAAAACCTACTCTTCCTCAAAGATCTATAACAATTGAGATGGCTTTCACTTGAA
GATAACCCTATAAAAGATTAAATAAATTATGTTTACACAATTATCACTTTATTGCCAAAC
CTATAATTTTTGGATGGTGCTAAAATAAGTGAAAGCTTAAAGAAGGAAAGTGAAGAAAGC
TTAAAATAATAAGATCAAATGTTGGATGTTCTTTTAAAAAACTATATTGAATTAATACAG
TTAAATGATGCTCTAAAAAAGATAAGACTACACTCAGAGCTCAAAACTGAATACAATTTT
AATCTAGATACACCACCTTTTTGTATTGAAAAATACTAGAGATATTTTAAGTTGCAGAGA
ATATTTGATAATTAAGATCCTGATATTTGCGTTTAATTTAAAATTTCCCTTCTTAATGAT
GCCCATCTACTTCTTAGCGAACCTTAAAGCATTGATAGCTTAAATGAGGCATTTGAACAA
CTTCGTTAAAAGCAAATTGATAAGAAACTAGAATTAATTGATAAAATAGAATAAATTATC
TAAGAATAAAATAATGAATTTTTTAAATAAAAATTAGCTCCTCATTCATAAAATGTATAT
AAATCTTCAAGGTCAATGAGTGCATCAAAGAAATCACAGCTTAATAAGAGCAATAGTAGT
TCACTATTAAGGAGTAGCTCACATAAGAAAATAGGAGTGCCTTAATAAAACTAAGAGAAT
ATAGAATAAACATATTAAAATAAGAATATTCATCATACATTTAACACAAATAATTCTTAA
ATGAATTTAAGTATTATGAGCAATGGGGGAAACTAGAGCAGGAGACAGTTGAATAGCTCA
AACTAAAAATTACAGCATTAAACAAGTTCTCAATCATATTTTTCAACTTCTAGAATTAAC
AACTCTCTAAATACCATGAACAAATTTACTAAATTAACAGAATTCGCAAATCATCCATCA
AATTGTCTAAAACTAAGAAATAGTGATAAAGATACTTTAATATGTTAGTTGAGTGAGTCT
CTTAATGCTAAAATTGCTGAATATGTTAAACTTGAAGAAACAAATTAACGTTTAAGAGTT
GAAATAAACGACTAATGCAAATAGGCTGATAATATTAATTCAGATTTATAAAACTAAGTC
TTATTTAAAGAAGAATAAATTAAAAACTGTTAAGAATAAATGAAAGCCATGGAATAATCA
TTAAAAGACACTAAATAAAAGCTAAACGTTCTCATATTTCAAAATTATGAAATGGAGAGA
TGCAAAAGTAACTTAGATAAATCTGAATAAATTATTTAAAGCATGAATGCTGCGTTTTAA
TATCAAGAATTTCTAGATGAAAAAGAATCATTTGCTAGAGATTATTATAATAAACGAGTT
TTATAGTTCGGCCTTAATTGCCTAAAATTTGCTACTTAATAAACTAAAAAGGTTAATTCC
TTTTAGCAAAAAATTGAGAATAAATTTATGCACAATTAAGGAGCATTTTTGTTTAAAAAA
TGGATAGAATTCACCATTAAAGGATAACGTGTAAAGCATTAATAAGCTGTTTAGAATAAC
TAAATAGTAACAACGTTTTTCAAATAATGGAAAAATAATGCTGCATTCAGTAAAAATATT
TAAAAATTTAAACTGAAATAACAAAAAAGAATAGAATTAGAAACATATTGTAAAATAAAA
GATTTTGCTAGAGGTTCAAAAAAATTAAAAGTTTAAGATTCTGTCGCTGTAAAATTTCAC
TAAAAAAAGTTAAAAAAAGTTGCTTTTTAACTAATTAAGTTATTTTATTAAAAATATAAC
ATCGTTAACAAAAAAGAGCTTAATGCTATAAATCGACAGGCTTAAAATCATTACACAAAT
TACAAAAAGAAAGTCGTTTTATTTTTTTGGAAAAATTACATTAAATAGAATGTTTTACCT
ATGAAGGAAAAATCTAAAAAGAGTTTAATTCACTTTAATTCTAAAATACTTTAAAAATCG
TTCTACAGATGGACTATTTTAAGAACAGTTAGACTTCAAAATGAGCAAAAAGCTGAATTA
GCTGCTTAGAGAAAACAAAAAAAATTTTTATAAAAGTTGTTATGGAGATGGAAAGATGAC
TATCATAAGATATATGTTAAAAAGAAAACATTTAGCAGTAAATACAACTTTTAATTAAAA
ATAAAATACTTTAAGGCACTATGCTAAGCCAAGACAATAAGAGAGAATAAAATTGCAAAG
TAGTTATCCTTATAATCTAAAATCGATCATAAACTTATTATTAAAGTGATAAAATCATTA
AAAATGAATGTTTCCAATAATAAAAAAATAGAAAAAAGGGCTAACTAAATTATTTCAGAA
AAAAATTAATAAATTCTGTAAAAATACTTCAAAGGAGTTAAGTAGTATTTATAGGAGTAA
AAGATATAGAAAGAAAGAGTCAAGAAAATAGAATTAAAGATATAATCAAAATACTTGAAC
ATTATGAAAAAGAAGGCTGATAGGTAAGCTAACAGAAAGGCAAAGAGCATTGCTTTAAAA
AGCCAAAAGGTTTTTAAATTAAATTAAAATTTTTAAAAAGCTTTCTAATTCTGGAAAGTT
TATGTTGCTAAATAAAAAAGATAACAAAGATTGCTAAGTAAAGCTGAATTTTATCATAAA
TAAAGAGTATTTCATTACTTGATTTTGGGAATAAAGGACAATAATATATAGTAATTTAAA
AGAAAAATCATTGAATAGGAGCTTATGCTTAAGAGTCTACAGGATGCATGCAACTAAAAT
ATGAGATATGCTAACGAAGCTGATAATAAATAAATTGATTATATTAACAAACTAGATATT
CTCAGTTAAAACATAGATTTTTTGAAATCTGAAATTACTGAAAAGGATATGTTTATTCAA
GAATTAAAGTTAAATATTTCTTAAAAAAATGAATAAATTGAAAATTTATAAACCGAACAC
ATGATTACTTCAACAGAAAATAAAGAACTTCTGAAAAAGCTAAATATTTTAGACAATGAA
CTTGTCAATAAATCTTCTAAGTATGAGTAAATGATATTTGATTTGAAGGAGTAATATTCT
CAACTCAATATGAACATTTAATAAATGCAATCTGATTTTGAAATTAAAGAAAGAGGATAC
AAAGAATAATATGGAGCATTATCTATTAAAAACGCTTCTTAAGATAATTATATTGCCAAA
TTAGAATAGCTTAAAGTAGAGCTAGAAGAAAGATGCACATCTGCAGAAATACTATCTTAA
AATTAAAAAAATGAGAATTAAGACTTGCTTAGGGTTATTTCAAGCTTTGAAGACGAAAGA
GATCAGTATAAATAAAAGATAGAAGAATGTCTTAAGTTAATTGAAGAAAGCAGTGCGATT
TATGAAAATAAATTACTTGAATTAAAAGAGGAAAAGAATAACTTGGATACTGAAAATATT
GTTTTAAAAGAGAAAAATCACAGATAAGAAAATGAAATTTTAGATTTGAAGAATGATTTA
AGAAGATTAGAGTATCAGGTTGAATTAATGGTAGTAGAGCAGCATAAATAAACTATCTAA
TTTATAGATAATCTAAGCAATAATAATAATCCTAATAATATAAATACTAATTAAGTAGGA
AGTAACAATAGTACAGCAAATAAATTTTATCAAAATTTTAATGCAAACTAGTTCAAAGTA
AATTAAAATAATCAATACGATTCCATTTAGCAACCAAACTATGAAACATTGGCATAAGTT
TCTACTCCAATATAAACCCCAAAAGCAGAATATACTTATGAAAGTGCTATTAACAACAAC
TATGTATCTTCAAGAGCAATTCAAAGCATTGATGAAAGATAGTTGCAACAGTAATTTGTT
AACATTCAAGATTTCCTAAGACCTAGAAGACAAGATATTTCTCCTTTAAAGAGCTATTTA
ACAAGCAGAAGAGAAAAGTCATAATAAAAAGAAGAGCATGTTTATGTTCTCCCACAGACC
TAAAAAGCACAAACTTCGAAAAGAATATCAATTACATCACCATCTTAATTTGAAAATAAA
GCAGAAACATCTAACTTTTATTTAAAATCTTAACCTTAGCTCAATCAAACCTAGCACTAT
TAAATTTAAAATTACTTAGCACAAAACTCTTAAAATAGCTAATAAACTTAAAAATTTCCA
TAATAGAATTTAATTATTGATAGCATACAAAAGGAAGTAAGATCAATGAAATCTAACACA
TCTGCTTTAAAATTAAATATCGAAAGAAGGCTATAAAATTTGAACCAAAATCTTGATTCA
GACATTATAACACTTAAATAACAAAGACTTAATTCTTAAAATGAAGATTTTGAATAATAT
GATCTTTGA


>TTHERM_00997760(protein)
MKKGQRLKEYKLSEALKSFPQKDSNLINLSFKNISVIDNVPKKYHAVESLDLRGNILTSI
KGVTQFQKLVHLNLATNNILNLENLLFLKDLQQLRWLSLEDNPIKDQINYVYTIITLLPN
LQFLDGAKISESLKKESEESLKQQDQMLDVLLKNYIELIQLNDALKKIRLHSELKTEYNF
NLDTPPFCIEKYQRYFKLQRIFDNQDPDICVQFKISLLNDAHLLLSEPQSIDSLNEAFEQ
LRQKQIDKKLELIDKIEQIIQEQNNEFFKQKLAPHSQNVYKSSRSMSASKKSQLNKSNSS
SLLRSSSHKKIGVPQQNQENIEQTYQNKNIHHTFNTNNSQMNLSIMSNGGNQSRRQLNSS
NQKLQHQTSSQSYFSTSRINNSLNTMNKFTKLTEFANHPSNCLKLRNSDKDTLICQLSES
LNAKIAEYVKLEETNQRLRVEINDQCKQADNINSDLQNQVLFKEEQIKNCQEQMKAMEQS
LKDTKQKLNVLIFQNYEMERCKSNLDKSEQIIQSMNAAFQYQEFLDEKESFARDYYNKRV
LQFGLNCLKFATQQTKKVNSFQQKIENKFMHNQGAFLFKKWIEFTIKGQRVKHQQAVQNN
QIVTTFFKQWKNNAAFSKNIQKFKLKQQKRIELETYCKIKDFARGSKKLKVQDSVAVKFH
QKKLKKVAFQLIKLFYQKYNIVNKKELNAINRQAQNHYTNYKKKVVLFFWKNYIKQNVLP
MKEKSKKSLIHFNSKILQKSFYRWTILRTVRLQNEQKAELAAQRKQKKFLQKLLWRWKDD
YHKIYVKKKTFSSKYNFQLKIKYFKALCQAKTIRENKIAKQLSLQSKIDHKLIIKVIKSL
KMNVSNNKKIEKRANQIISEKNQQILQKYFKGVKQYLQEQKIQKERVKKIELKIQSKYLN
IMKKKADRQANRKAKSIALKSQKVFKLNQNFQKAFQFWKVYVAKQKRQQRLLSKAEFYHK
QRVFHYLILGIKDNNIQQFKRKIIEQELMLKSLQDACNQNMRYANEADNKQIDYINKLDI
LSQNIDFLKSEITEKDMFIQELKLNISQKNEQIENLQTEHMITSTENKELLKKLNILDNE
LVNKSSKYEQMIFDLKEQYSQLNMNIQQMQSDFEIKERGYKEQYGALSIKNASQDNYIAK
LEQLKVELEERCTSAEILSQNQKNENQDLLRVISSFEDERDQYKQKIEECLKLIEESSAI
YENKLLELKEEKNNLDTENIVLKEKNHRQENEILDLKNDLRRLEYQVELMVVEQHKQTIQ
FIDNLSNNNNPNNINTNQVGSNNSTANKFYQNFNANQFKVNQNNQYDSIQQPNYETLAQV
STPIQTPKAEYTYESAINNNYVSSRAIQSIDERQLQQQFVNIQDFLRPRRQDISPLKSYL
TSRREKSQQKEEHVYVLPQTQKAQTSKRISITSPSQFENKAETSNFYLKSQPQLNQTQHY
QIQNYLAQNSQNSQQTQKFPQQNLIIDSIQKEVRSMKSNTSALKLNIERRLQNLNQNLDS
DIITLKQQRLNSQNEDFEQYDL


>TTHERM_00997760(gene)
CTAAAAACTTTATATTATTTCTAAATAAGTAGCAAGTAGGTCAAACAATATTATTTAGTT
AATACTAAGAAAAAAGGATATTTTAATTTTTAGATTAAAGGAAAATATTTAAGTTTCGAT
TTATCAATAAATATCAGATAGATGAAAAAGGGATAACGCTTAAAAGTAATGCTAAAATAT
TTTAATTTTATTTTAAATTTAAGATTTTAAAAACTAATTTAGCCAAGTATTATTATTAAT
TATACTTTTTAAAAATGCAAATAGGAATATAAAGTAATAAATTTTATATATGAAACACAT
TAGCCATTTGATAAAAATAATTTTTTAAAATTAGCTATCTGAAGCACTTAAATCATTTCC
TTAGAAAGATTCTAATTTAATAAATCTATCTTTCAAAAACATATCTGTTATTGATAATGT
ACCAAAGAAATATCATGCTGTAGAATCTTTAGACTTAAGGGGAAACATTTTAACTTCTAT
TAAAGGAGTTACATAATTTTAAAAGCTTGTTCATTTAAATCTGGCAACCAACAATGTAAA
TTATATTTGATATGCTAGTCTGTTTGATATAAATTTATTCATCGTTTAACAACTTTAGAT
TCTTAATCTTGAAAACCTACTCTTCCTCAAAGATCTATAACAATTGAGATGGCTTTCACT
TGAAGATAACCCTATAAAAGATTAAATAAATTATGTTTACACAATTATCACTTTATTGCC
AAACCTATAATTTTTGGATGGTGCTGTAATTAACCAAATTTTGATGTTTTCTTAAAATTA
TAAATAAAACTTATTTATTATTCTATGATATATTCCTCAATTTAAAAATATATGACTCAA
TAGTAAAGAAATTTTAATATGATAGAAAATAAGTGAAAGCTTAAAGAAGGAAAGTGAAGA
AAGCTTAAAATAATAAGATCAAATGTTGGATGTTCTTTTAAAAAACTATATTGAATTAAT
ACAGTTAAATGATGTAAGGTTATTAAATTTTTACTGAAAATAAAATTATTTATTTAAAAT
AGGCTCTAAAAAAGATAAGACTACACTCAGAGCTCAAAACTGAATACAATTTTAATCTAG
ATACACCACCTTTTTGTATTGAAAAATACTAGAGATATTTTAAGTTGCAGAGAATATTTG
ATAATTAAGATCCTGATATTTGCGTTTAATTTAAAATTTCCCTTCTTAATGATGCCCATC
TACTTCTTAGCGAACCTTAAAGCATGTAATATCAAAAAATGTTTAAATAAAAGCTTAATT
ATTATTAAAATAAGTGATAGCTTAAATGAGGCATTTGAACAACTTCGTTAAAAGCAAATT
GATAAGAAACTAGAATTAATTGATAAAATAGAATAAATTATCTAAGAATAAAATAATGAA
TTTTTTAAATAAAAATTAGCTCCTCATTCATAAAATGTATATAAATCTTCAAGGTCAATG
GTATGAAATTAAAATTTTTAGGAACTATAATAATAAAGCAATAAATATATTAATAATTAG
AGTGCATCAAAGAAATCACAGCTTAATAAGAGCAATAGTAGTTCACTATTAAGGAGTAGC
TCACATAAGAAAATAGGAGTGCCTTAATAAAACTAAGAGAATATAGAATAAACATATTAA
AATAAGAATATTCATCATACATTTAACACAAATAATTCTTAAATGAATTTAAGTATTATG
AGCAATGGGGGAAACTAGAGCAGGAGACAGTTGAATAGCTCAAACTAAAAATTACAGCAT
TAAACAAGTTCTCAATCATATTTTTCAACTTCTAGAATTAACAACTCTCTAAATACCATG
AACAAATTTACTAAATTAACAGTAATATTTATTTTCTAACACATTGCTATTTTCCTTAAT
TAAAATGTATAATTAATAAGATCTTAAAAAACTAAAAAAATCAAAAGATATTCATTCGTT
TAAAAGAAATGGATGAAATAAAATTGAAAGGATTAATCAAAAATATTTAAACAATTTTTT
AAGTTAATTTTGATAAATAAACTAATTAAAATTATCTGAAAAAATATTTATCCATTTAAA
AAATAAAATTTATTATTTATTAATTTTAACAAAAGGAATTCGCAAATCATCCATCAAATT
GTCTAAAACTAAGAAATAGTGATAAAGATACTTTAATATGTTAGTTGAGTGAGTCTCTTA
ATGCTAAAATTGCTGAATATGTTAAACTTGAAGAAACAAATTAACGTTTAAGAGTTGAAA
TAAACGACTAATGCAAATAGGCTGATAATATTAATTCAGATTTATAAAACTAAGTCTTAT
TTAAAGAAGAATAAATTAAAAACTGTTAAGAATAAATGAAAGCCATGGAATAATCATTAA
AAGACACTAAATAAAAGCTAAACGTTCTCATATTTCAAAATTATGAAATGGAGAGATGCA
AAAGTAACTTAGATAAATCTGAATAAATTATTTAAAGCATGAATGCTGCGTTTTAATATC
AAGAATTTCTAGATGAAAAAGAATCATTTGCTAGAGATTATTATAATAAACGAGTTTTAT
AGTTCGGCCTTAATTGCCTAAAATTTGCTACTTAATAAACTAAAAAGGTTAATTCCTTTT
AGCAAAAAATTGAGAATAAATTTATGCACAATTAAGGAGCATTTTTGTTTAAAAAATGGA
TAGAATTCACCATTAAAGGATAACGTGTAAAGCATTAATAAGCTGTTTAGAATAACTAAA
TAGTAACAACGTTTTTCAAATAATGGAAAAATAATGCTGCATTCAGTAAAAATATTTAAA
AATTTAAACTGAAATAACAAAAAAGAATAGAATTAGAAACATATTGTAAAATAAAAGATT
TTGCTAGAGGTTCAAAAAAATTAAAAGTTTAAGATTCTGTCGCTGTAAAATTTCACTAAA
AAAAGTTAAAAAAAGTTGCTTTTTAACTAATTAAGTTATTTTATTAAAAATATAACATCG
TTAACAAAAAAGAGCTTAATGCTATAAATCGACAGGCTTAAAATCATTACACAAATTACA
AAAAGAAAGTCGTTTTATTTTTTTGGAAAAATTACATTAAATAGAATGTTTTACCTATGA
AGGAAAAATCTAAAAAGAGTTTAATTCACTTTAATTCTAAAATACTTTAAAAATCGTTCT
ACAGATGGACTATTTTAAGAACAGTTAGACTTCAAAATGAGCAAAAAGCTGAATTAGCTG
CTTAGAGAAAACAAAAAAAATTTTTATAAAAGTTGTTATGGAGATGGAAAGATGACTATC
ATAAGATATATGTTAAAAAGAAAACATTTAGCAGTAAATACAACTTTTAATTAAAAATAA
AATACTTTAAGGCACTATGCTAAGCCAAGACAATAAGAGAGAATAAAATTGCAAAGTAGT
TATCCTTATAATCTAAAATCGATCATAAACTTATTATTAAAGTGATAAAATCATTAAAAA
TGAATGTTTCCAATAATAAAAAAATAGAAAAAAGGGCTAACTAAATTATTTCAGAAAAAA
ATTAATAAATTCTGTAAAAATACTTCAAAGGAGTTAAGTAGTATTTATAGGAGTAAAAGA
TATAGAAAGAAAGAGTCAAGAAAATAGAATTAAAGATATAATCAAAATACTTGAACATTA
TGAAAAAGAAGGCTGATAGGTAAGCTAACAGAAAGGCAAAGAGCATTGCTTTAAAAAGCC
AAAAGGTTTTTAAATTAAATTAAAATTTTTAAAAAGCTTTCTAATTCTGGAAAGTTTATG
TTGCTAAATAAAAAAGATAACAAAGATTGCTAAGTAAAGCTGAATTTTATCATAAATAAA
GAGTAAATTAAATTAAATTTAAAAAGCTTGTAAATATTTATAAAAATATTTTTTTTTTTA
AAGGTATTTCATTACTTGATTTTGGGAATAAAGGACAATAATATATAGTAATTTAAAAGA
AAAATCATTGAATAGGAGCTTATGCTTAAGAGTCTACAGGATGCATGCAACTAAAATATG
AGATATGCTAACGAAGCTGATAATAAATAAATTGATTATATTAACAAACTAGATATTCTC
AGTTAAAACATAGATTTTTTGAAATCTGAAATTACTGAAAAGGATATGTTTATTCAAGAA
TTAAAGTTAAATATTTCTTAAAAAAATGAATAAATTGAAAATTTATAAACCGAACACATG
ATTACTTCAACAGAAAATAAAGAACTTCTGAAAAAGCTAAATATTTTAGACAATGAACTT
GTCAATAAATCTTCTAAGTATGAGTAAATGATATTTGATTTGAAGGAGTAATATTCTCAA
CTCAATATGAACATTTAATAAATGCAATCTGATTTTGAAAGTAAGTTTTGTTCATGTTTA
CAAAATTTTAAGAAAATTAAAGCTTTTAATTTTTCTTTAAAATAATTCTTAAAATTGAAT
TGAATGAAAATTACTAAAATTAATATTTTCTATAAAATTAAAAAATGTAAAATTAGTTAA
AGAAAGAGGATACAAAGAATAATATGGAGCATTATCTATTAAAAACGCTTCTTAAGATAA
TTATATTGCCAAATTAGAATAGCTTAAAGTAGAGCTAGAAGAAAGATGCACATCTGCAGA
AATACTATCTTAAAATTAAAAAAATGAGGTTTTAATTAATTGATAAATATTAAAATAAAT
TAATATAATTTTTTTAATAGAATTAAGACTTGCTTAGGGTTATTTCAAGCTTTGAAGACG
AAAGAGATCAGTATAAATAAAAGATAGAAGAATGTCTTAAGTTAATTGAAGAAAGCAGTG
CGATTTATGAAAATAAATTACTTGAATTAAAAGAGGAAAAGAATAACTTGGATACTGAAA
ATATTGTTTTAAAAGAGAAAAATCACAGATAAGAAAATGAAATTTTAGATTTGAAGAATG
ATTTAAGAAGATTAGAGTATCAGGTTGAATTAATGGTAGTAGAGCAGCATAAATAAACTA
TCTAATTTATAGATAATCTAAGCAATAATAATAATCCTAATAATATAAATACTAATTAAG
TAGGAAGTAACAATAGTACAGCAAATAAATTTTATCAAAATTTTAATGCAAACTAGTTCA
AAGTAAATTAAAATAATCAATACGATTCCATTTAGCAACCAAACTATGAAACATTGGCAT
AAGTTTCTACTCCAATATAAAGTATATTTTATTATAAAAAATTTATTAGAAAATACTTTG
ATTTAATTAAAAGCCCCAAAAGCAGAATATACTTATGAAAGTGCTATTAACAACAACTAT
GTATCTTCAAGAGCAATTCAAAGCATTGATGAAAGATAGTTGCAACAGTAATTTGTTAAC
ATTCAAGATTTCCTAAGACCTAGAAGACAAGATATTTCTCCTTTAAAGAGCTATTTAACA
AGCAGAAGAGAAAAGTCATAATAAAAAGAAGAGCATGTTTATGTTCTCCCACAGACCTAA
AAAGCACAAACTTCGAAAAGAATATCAATTACATCACCATCTTAATTTGAAAATAAAGCA
GAAACATCTAACTTTTATTTAAAATCTTAACCTTAGCTCAATCGTATATTTTATTTTTTA
GTAAAAATAAAAAATATTTAACATTTTATTTATAATAGAAACCTAGCACTATTAAATTTA
AAATTACTTAGCACAAAACTCTTAAAATAGCTAATAAACTTAAAAATTTCCATAATAGAA
TTTAATTATTGATAGCATACAAAAGGAGTAAACCTAATTTCTTATGTTTATCCATTTATT
TTTAACTATTTTTTATGATAAAAAAGAGTAAGATCAATGAAATCTAACACATCTGCTTTA
AAATTAAATATCGAAAGAAGGCTATAAAATTTGAACCAAAATCTTGATTCAGACATTATA
ACACTTAAATAACAAAGACTTAATTCTTAAAATGAAGATTTTGAATAATATGATCTTTGA