Identifiers and Description

Gene Model Identifier

TTHERM_00059100

Standard Name

SFR8 (Sfi1 repeat protein)

Aliases

PreTt13094 | 4.m00493 | 3707.m00138

Description

cortical row basal body localization; predicted to have 9 Sfi1 repeats; Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07529 ) HSA
  • ( PF02630 ) SCO1/SenC
  • ( PF00560 ) Leucine Rich Repeat
  • ( PF04702 ) Vicilin N terminal region
  • ( PF02671 ) Paired amphipathic helix repeat
  • ( TIGR00020 ) peptide chain release factor 2
  • ( PF04642 ) Protein of unknown function, DUF601
  • ( PF08946 ) Osmosensory transporter coiled coil

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00059100

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02013.19.997093137033517e-262leucine rich repeat family pro
tein (1379 aa)
OxytrichaContig4888.0.g900.000000000000005001692698841201Leucine Rich repeats (2 copies
)
WormBaseWBGene000033900.000000009000371344152433locus:mog-2 Probable U2 smal
l nuclear ribonucleoprotein A
status:Confirmed UniProt:Q
9BLB6 protein_id:CCD61684.1
SGDYPL213W0.0004000184047659232LEA1 Component of U2 snRNP; di
sruption causes reduced U2 snR
NP levels; physically interact
s with Msl1p; putative homolog
of human U2A snRNP protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00059100(coding)
ATGAGTGTTTCAACTTCGTAATTAGGTTATCTCTCAAAATTTAAATAGCGCGCTATTGAT
AAAAAACAACCACTTAAAGATGCGATTCAGTAAAGTAAAGCACTATTAAGCAATTAGATA
ACTCTTTCAGAGGCAATTAAGAAATATCCTTAGTGTGCAGATGAATTTAAAATTAGATTA
GTTCAGAAATAAATTAAAGAAATTGACAAAGTTCCAACTTTTTATAAAAAAATTGATACA
TTATATATAAGCAATAACAGCATAAAAACATTGGATGGAATAGAATAATTCACTCATTTA
CAACACTTATCGATCACTAACAATAATCTAAAAGATATTTCAATGATTAAGCTTATTAGA
AAGTTAGACAGCTTAGAAAGTCTGAACATGTCTGGGAATCCTGTAACTAAACATCCAATT
TACAGATAACTCATTTTAACCACACTTCCAAATTTGCAATAACTTGATGGAAAAGTTGTC
ACTAAAGAAGACAAATAAATTGCTGAAGTTTAACTTAAAAAGTAAAATTCACTTCTTGAC
CTGATTCTCAATAATTACATAGAAATAAGAAAATTGAATTATATTTCTAAAAAACTTGAC
TTACATTAGTAGCTTGGACAAAACCATTTTTAGTTTATTAATTATCATCCTCAATTTTAA
AATATGCCTGTCAATTTGTAACAGATAAAAAAGTAATATGATTTTTAGTCTGACTTCCCT
TAGTATGTCAAAGATGAAATGGTTGATAATATAATGTCTGATATTTTAACCTTGTACGAA
TCATTAAATTAACTGTAAGGAGAATAAGAATAAAATTATGAAAAGGCTTTTACAGAGTTA
TTGATGAAATAACAATAATTGATGGCTCAATTAAATATATAATGTTAGTAATAGGTAGAT
AAACTAAACTCATTAAAAGCAAACATAAAAGTTAAACATAAAGAGCAACCTTTTGCATCA
TCTCAATATTCTTAATTCAATTCTACTTAAAGATCTTAATAGTTCTAAGATTAATAGTAA
GTTTTGTATTCACCTAAAGTTACAAAAGAAGAAATTCGTACAAAATCTCCACAATAAGAA
CAAGAATATAATTAAAATACCTTGTATTACAGATCCCTACAAAAAAGCTTAAAGGGATAA
AAATAAGAGGAAGAAGATTAAAAGCACAAAACTTAATCAACAAAAAGGTCACAATCACCA
AATAGAACAATTCCTGTTCCACTTTCATAAGAAGGTATCCCAACAAGCAGCAAAAAAATT
ACTTAAAAAGTAAGAAAATAATAAATTTAAGAATAAGGACTAAATTCTTCAAAGAAAAGT
ATTGAGAATATCACATTTTAATAATCAAACAGCAACAGAAATTATCATAAATAGAATTTA
AATTCTTAAAATTAAGATTGTTGTCGTAGATATATGAACTAAGATGACCATTCTTTAGAA
GAATTTAAAAAGTCTTAGTCATCTCGTTCACCTTATCGTTAAACTAATAATGATTTAAAA
GGAATAATTAGTGATTTAAATTAAGTTGTGTAATAGAAAGAAGACGAACTTAAAGAACTT
TAATTTATTAATTAAAAAATTTTAGATGAATAGTAAGAAAAAGATAAAGAAAAAATTGAG
CTATTAGATTTTGCTTAAAGAAGGATTTAAGATATGTAAGATAGGGAAATAGGACAAAAT
GAGATTGAATTCGAAATTCAGGAGTTGAGATAGTAAATAAATTAGTTAATGCAAAAGAAT
GTTGATTTAGAGAAAGAGGCATAAGAAAAATCAGAACTTGAAAGATAAATCATGTTTAAA
GAGGGACAAATTCAAGAACTTGATTACAGAAACTAAATTGAAGAAAAAGCAGAAGCTTTT
AATGAAATAAGATTAAAAAAGTTATTGATGAAATATTTAGGTTTTGCAGTTTAAACAGAG
TAAAAAATATAGTAATTCAGAGCAAAGAAATTATAAGAATAATCTGACTACTTACAAAGT
GAATATTTTAGAGCTTGGTTGAGGAGAGTCATTGTAAAGAAATTTGAAAAGGCATATATT
TATGAATAGAAATGCACCTTGTAAAAAAAGATGCTTACAACATGGAGAAAAAATATTATT
TTCTAGTAGAGATTGTCTATCATGAAGGAGAAAAGATAAAAAATATGTTTGAAAAAAAGT
ATGATATGTTGGAAGCAAAGCTAACGAATTTAGCAAATAAAATAGCAGAAAAAAGAAAAA
ATCTTGAAGATTTTCTAAAAAAAGGTACAATTGAAAGCTTTTAAGTGTTTACGTTCTAAT
TTATTAGCAAGTAAAATAAATCCTATTAAAGAAAGAAGATTAATGGATTAAGCCACCAAC
TTTTACAATAAAAAGTTAAGATGCAAAATGTTTGAGTAGTGGTAAAATTACTAATATGAT
ATAGTTATTCCTTAGAAAAAAAGAATATAACATATTTAAAAATCTCTCTAGTTCTAGTAA
ATGCAAAGAATCTTTAAAGTATTTCAATAAATTCGTTTGCAAGGTAGATAAAATTTGCTT
ACTGCAAGATAATATGAGACATTCTAAATTAAGAGATTTAAAAACTTAATTTTCAAGCGC
TGGAAATAAATTTATTTAAAGAATAGAACTTAGAAAGTAGAATTTTAAGCTTTAGTTAGA
CACAATTCTTTGAAATCTATGTTTAAGCAATGGAGAAACTCATTTTTAGATAGCAGAAAT
AGCAAGAAATAGACCTTAAAGGTTCTTAATTATCTAAGAAAATAAATTTAGGCTAAATAC
TTTTAAGCAATTAAATAATATCGCAAAAATAAGATTGAAGAAAGAGCTAAATATGATCAA
GTGTAGAAAATCACTCAATCCAATTTTTATAAGTATTGTTTCAAGTAATGGTACTTGAGA
ATGATACCATTAAATGCTGCAAGATAATAGTAAGTTAAAAATAAAGCAAATTTAATTGCT
AAATGTTTTTATCAAATTAAAAACTATGCTAAAAGATCAATTAAAAAGAAGTTCAATCAA
ATTAATTTAGATAATTATTTAGATTTTAAGCAAAAAAAAAAATTGATTTAAAGTTTTAAT
GATTTCAAAAAGCACACTCAATAAGAAATTAGATTGAAAAAATTAGTTATTAATTTTAGG
ATAAACTAAAAATTTAAGATTTATCGTATATTCTTGAATGCTTTAGCAAGGGAAAATATC
CTTAAGCAAAAATAGATTTTATATCAAATGAACCATGAATTAAAGCTGAATGAAACAAAT
ATAAATTCTAGCTCTGAAGTTATTCGTTCTTATGAAAACGAAAAATAGAATTTAATTTAT
GAAATTAATTAGTTAAAAGAAGAAAATTTTGGCTAAAAACTAGCTATTGAAGAGTTTTAG
CAAATTCAGATTAAATGTAACTCTTAATTAAGATCAATTGAGAGATAAGAAAAAATATTT
AAAGAAGAAAAAGAAGCTTATGAGTTAAGAATAAGGGATTATGAAGAATTGCTTAAATAA
ATCCATTCAGAATATTAAAAATAAATTCATTAAAAAGACATAGAAATTCATGAGTCTAAA
AATGAAACCAGAGCCGTCTAAAAGTAAATATCTATCCTCCAAAGAGAGCTTGAATTTAAA
TAAAATACTATTTTGGAAACTGAAAAAGCTTTACTTAATAGAGGAGAATAATCCTCTATA
CTTCTGAGAGAGACAGAAAAAAAATTATAGAATTCAATAATGATGGCTAATGAGTTTAAA
ACTAAAATTGAAGAATTGTATTCAGAAAATGAAGAATTAAAAGATTAAGTATATGGAAAA
GATTTGGACATTGAATAATTGAAATCTAAATTAAAAGAAAGTTTAGATTTAATCAGAGAG
TCTTCTGACATGTATGATTAAAAAATAAATGACTTCAATGCAATTATTGAAAGCAAGAAT
ACACAAATATAGGAATTTATAGACAAGCAAATCCGATTCTAAGAATAAATTAATGAACTT
TAACAAGAATTAAGGAAATAACATTTAGAACTAGAACTATTTTAGGATATACAGCCAATG
CTCGAACATCCTCAAGTGAATTAATATTATTAAGAATACTAAGATCTTTAGAACGAGCTT
GATACTTAGAGAAATAATTTGAAGAAGAGAATGGATAAACTAAATAGAAGCATTAATTAG
ATTTAAGATATTGATAGAAGAGTTAAGAATTAGACATTAAGAGACTAAAATTAATAATAT
GAAAGGACAAGTCCGCTCTATAGCAGATAGGGTTCTCCAATGAGTGAAAGGATTATAAAG
GAATAAGAAAATACTGGAAATGTTTTAAGAAATAGTGGAATTAGCACTATTAAAAGCTAC
TAGCCTTAATCCGAAATGCAAGTTAATTTTAGAAGTGTGGACACCTTTTCTAATTTTCAC
AATCAGAGTTATCACAATACTTATAATCTACATTCTGTCGAGGATGTTCATACAGCTCCT
GCATAAAGAATTCACACAGACCCTTCTAATGCTAGAGAAGCTCATTATTAAGTAGAAAGA
AATGCCTTAACAAGAGCAAGTTATGATCCTTACAATCGCTTTGGTGAAGAAAATTTTGCT
ACTTACGAAGACTGTGAAACAGCTGAATAAATTCATGAAGAGTTAGAAAGAAACAAAGCT
AACAGAAAGTTATTTAAGCAAAATATAGAAAGAAGGATAAGCAGATTAGAAAACAATATC
GATAGAGATTTAGCATAAAACGAAAGAAATAAATCAAGGTCTTAATCCCCAGAAAACTAC
TACGTATAAAACTGA


>TTHERM_00059100(protein)
MSVSTSQLGYLSKFKQRAIDKKQPLKDAIQQSKALLSNQITLSEAIKKYPQCADEFKIRL
VQKQIKEIDKVPTFYKKIDTLYISNNSIKTLDGIEQFTHLQHLSITNNNLKDISMIKLIR
KLDSLESLNMSGNPVTKHPIYRQLILTTLPNLQQLDGKVVTKEDKQIAEVQLKKQNSLLD
LILNNYIEIRKLNYISKKLDLHQQLGQNHFQFINYHPQFQNMPVNLQQIKKQYDFQSDFP
QYVKDEMVDNIMSDILTLYESLNQLQGEQEQNYEKAFTELLMKQQQLMAQLNIQCQQQVD
KLNSLKANIKVKHKEQPFASSQYSQFNSTQRSQQFQDQQQVLYSPKVTKEEIRTKSPQQE
QEYNQNTLYYRSLQKSLKGQKQEEEDQKHKTQSTKRSQSPNRTIPVPLSQEGIPTSSKKI
TQKVRKQQIQEQGLNSSKKSIENITFQQSNSNRNYHKQNLNSQNQDCCRRYMNQDDHSLE
EFKKSQSSRSPYRQTNNDLKGIISDLNQVVQQKEDELKELQFINQKILDEQQEKDKEKIE
LLDFAQRRIQDMQDREIGQNEIEFEIQELRQQINQLMQKNVDLEKEAQEKSELERQIMFK
EGQIQELDYRNQIEEKAEAFNEIRLKKLLMKYLGFAVQTEQKIQQFRAKKLQEQSDYLQS
EYFRAWLRRVIVKKFEKAYIYEQKCTLQKKMLTTWRKNIIFQQRLSIMKEKRQKICLKKS
MICWKQSQRIQQIKQQKKEKILKIFQKKVQLKAFKCLRSNLLASKINPIKERRLMDQATN
FYNKKLRCKMFEQWQNYQYDIVIPQKKRIQHIQKSLQFQQMQRIFKVFQQIRLQGRQNLL
TARQYETFQIKRFKNLIFKRWKQIYLKNRTQKVEFQALVRHNSLKSMFKQWRNSFLDSRN
SKKQTLKVLNYLRKQIQAKYFQAIKQYRKNKIEERAKYDQVQKITQSNFYKYCFKQWYLR
MIPLNAARQQQVKNKANLIAKCFYQIKNYAKRSIKKKFNQINLDNYLDFKQKKKLIQSFN
DFKKHTQQEIRLKKLVINFRINQKFKIYRIFLNALARENILKQKQILYQMNHELKLNETN
INSSSEVIRSYENEKQNLIYEINQLKEENFGQKLAIEEFQQIQIKCNSQLRSIERQEKIF
KEEKEAYELRIRDYEELLKQIHSEYQKQIHQKDIEIHESKNETRAVQKQISILQRELEFK
QNTILETEKALLNRGEQSSILLRETEKKLQNSIMMANEFKTKIEELYSENEELKDQVYGK
DLDIEQLKSKLKESLDLIRESSDMYDQKINDFNAIIESKNTQIQEFIDKQIRFQEQINEL
QQELRKQHLELELFQDIQPMLEHPQVNQYYQEYQDLQNELDTQRNNLKKRMDKLNRSINQ
IQDIDRRVKNQTLRDQNQQYERTSPLYSRQGSPMSERIIKEQENTGNVLRNSGISTIKSY
QPQSEMQVNFRSVDTFSNFHNQSYHNTYNLHSVEDVHTAPAQRIHTDPSNAREAHYQVER
NALTRASYDPYNRFGEENFATYEDCETAEQIHEELERNKANRKLFKQNIERRISRLENNI
DRDLAQNERNKSRSQSPENYYVQN


>TTHERM_00059100(gene)
ATTAGTTTTAATATTTAGATATTCATATTAATAATTTTAGATAGCAACAGAATGAGTGTT
TCAACTTCGTAATTAGGTTATCTCTCAAAATTTAAATAGCGCGTATATACTTTACTAAAA
TTTTTATTATCATTTATAAAGCAGCTCCATTATCACTAAATTAAAAATATATTAAAATAA
ATATAAGGCTATTGATAAAAAACAACCACTTAAAGATGCGATTCAGTAAAGTAAAGCACT
ATTAAGCAATTAGATAACTGTAAAGACGTTTTTTTTATTTTATTATTAGCCTTAATGAAA
GAAAATTAATATCTAAACATCTACTTCCTAATAAACAGCTTTCAGAGGCAATTAAGAAAT
ATCCTTAGTGTGCAGATGAATTTAAAATTAGATTAGTTCAGAAATAAATTAAAGAAATTG
ACAAAGTTCCAACTTTTTATAAAAAAATTGATACATTATATATAAGCAATAACAGCATAA
AAACATTGGATGGAATAGAATAATTCACTCATTTACAACACTTATCGATCACTAACAATA
ATGTAATATTTATTATAATTTCTTGTTTTTTATTCCTCAGCTATAAAATAAAATCAAGCA
ATTCTTAAGAAAGTATTTTTTATTTTAAGAGTAAGCTTTGCAAATCTTATCAAAAAATTT
AAAAATTCACATAAAATTTAAAACTATTTAAGAAATAAAAGTTTGAAATAGGATTGACAA
TATGATTATTTTTTATATAAAAAAGCTAAAAGATATTTCAATGATTAAGCTTATTAGAAA
GTTAGACAGCTTAGAAAGTCTGAACATGTCTGGGAATCCTGTAACTAAACATCCAATTTA
CAGATAACTCATTTTAACCACACTTCCAAATTTGCAATAACTTGATGGAAAAGTAGAAAT
ATATTTATATAAAATACACACATATATAAATAATTTGTACTTTATCATACAATTTATAAA
CTACAGGTTGTCACTAAAGAAGACAAATAAATTGCTGAAGTTTAACTTAAAAAGTAAAAT
TCACTTCTTGACCTGATTCTCAATAATTACATAGAAATAAGAAAATTGAATTATGTAAAC
TTGCTAAAGAAATTAATTTGCTTGCTAAAAAAAAAATTATTTAAAATATATAGATTTCTA
AAAAACTTGACTTACATTAGTAGCTTGGACAAAACCATTTTTAGTTTATTAATTATCATC
CTCAATTTTAAAATATGCCTGTCAATTTGTAACAGATAAAAAAGTAATATGATTTTTAGT
CTGACTTCCCTTAGTATGTCAAAGATGTAAGCTTTTTCTTTATTTAATTAATAATATTAA
ATTATATATTTTTTAGGAAATGGTTGATAATATAATGTCTGATATTTTAACCTTGTACGA
ATCATTAAATTAACTGTAAGGAGAATAAGAATAAAATTATGAAAAGGCTTTTACAGAGTT
ATTGATGAAATAACAATAATTGATGGCTCAATTAAATATATAATGTTAGTAATAGGTAGA
TAAACTAAACTCATTAAAAGCAAACATAAAAGTTAAACATAAAGAGCAACCTTTTGCATC
ATCTCAATATTCTTAATTCAATTCTACTTAAAGATCTTAATAGTTCTAAGATTAATAGTA
AGTTTTGTATTCACCTAAAGTTACAAAAGAAGAAATTCGTACAAAATCTCCACAATAAGA
ACAAGAATATAATTAAAATACCTTGTATTACAGATCCCTACAAAAAAGCTTAAAGGGATA
AAAATAAGAGGAAGAAGATTAAAAGCACAAAACTTAATCAACAAAAAGGTCACAATCACC
AAATAGAACAATTCCTGTTCCACTTTCATAAGTAATTATTTCATTTTAGTTTTCAAAATA
AATATCTTGTTTTTAATGATTTTCTCTAATTTTTCTTTCATTTTTTAAATAAAATAAATG
TTTAATAATAAATAGGAAGGTATCCCAACAAGCAGCAAAAAAATTACTTAAAAAGTAAGA
AAATAATAAATTTAAGAATAAGGACTAAATTCTTCAAAGAAAAGTATTGAGAATATCACA
TTTTAATAATCAAACAGCAACAGAAATTATCATAAATAGAATTTAAATTCTTAAAATTAA
GATTGTTGTCGTAGATATATGAACTAAGATGACCATTCTTTAGAAGAATTTAAAAAGTCT
TAGTCATCTCGTTCACCTTATCGTTAAACTAATAATGATTTAAAAGGAATAATTAGTGAT
TTAAATTAAGTTGTGTAATAGAAAGAAGACGAACTTAAAGAACTTTAATTTATTAATTAA
AAGTAATTTTGTTACATTTATATTTTTTATAATATTTTTTTGTCAAAATAGAATTTTAGA
TGAATAGTAAGAAAAAGATAAAGAAAAAATTGAGCTATTAGATTTTGCTTAAAGAAGGAT
TTAAGATATGTAAGATAGGGAAATAGGACAAAATGAGATTGAATTCGAAATTCAGGAGTT
GAGATAGTAAATAAATTAGTTAATGCAAAAGAATGTTGATTTAGAGAAAGAGGCATAAGA
AAAATCAGAACTTGAAAGATAAATCATGTTTAAAGAGGGACAAATTCAAGAACTTGATTA
CAGAAACTAAATTGAAGAAAAAGCAGAAGCTTTTAATGAAATAAGATTAAAAAAGTTATT
GATGAAATATTTAGGTTTTGCAGTTTAAACAGAGTAAAAAATATAGTAATTCAGAGCAAA
GAAATTATAAGAATAATCTGACTACTTACAAAGTGAATATTTTAGAGCTTGGTTGAGGAG
AGTCATTGTAAAGAAATTTGAAAAGGCATATATTTATGAATAGAAATGCACCTTGTAAAA
AAAGATGCTTACAACATGGAGAAAAAATATTATTTTCTAGTAGAGATTGTCTATCATGAA
GGAGAAAAGATAAAAAATATGTTTGAAAAAAAGTATGATATGTTGGAAGCAAAGCTAACG
AATTTAGCAAATAAAATAGCAGAAAAAAGAAAAAATCTTGAAGATTTTCTAAAAAAAGGT
ATTTTTTATTTTTAGAGGATTTATTTAAAAAAAACAAAATTAATTATTATTTTTAATTAT
AGGTACAATTGAAAGCTTTTAAGTGTTTACGTTCTAATTTATTAGCAAGTAAAATAAATC
CTATTAAAGAAAGAAGATTAATGGATTAAGCCACCAACTTTTACAATAAAAAGTTAAGAT
GCAAAATGTTTGAGTAGTGGTAAAATTACTAATATGATATAGTTATTCCTTAGAAAAAAA
GAATATAACATATTTAAAAATCTCTCTAGTTCTAGTAAATGCAAAGAATCTTTAAAGTAT
TTCAATAAATTCGTTTGCAAGGTAGATAAAATTTGCTTACTGCAAGATAATATGAGACAT
TCTAAATTAAGAGATTTAAAAACTTAATTTTCAAGCGCTGGAAATAAATTTATTTAAAGA
ATAGAACTTAGAAAGTAGAATTTTAAGCTTTAGTTAGACACAATTCTTTGAAATCTATGT
TTAAGCAATGGAGAAACTCATTTTTAGATAGCAGAAATAGCAAGAAATAGACCTTAAAGG
TTCTTAATTATCTAAGAAAATAAATTTAGGCTAAATACTTTTAAGCAATTAAATAATATC
GCAAAAATAAGATTGAAGAAAGAGCTAAATATGATCAAGTGTAGAAAATCACTCAATCCA
ATTTTTATAAGTATTGTTTCAAGTAATGGTACTTGAGAATGATACCATTAAATGCTGCAA
GATAATAGTAAGTTAAAAATAAAGCAAATTTAATTGCTAAATGTTTTTATCAAATTAAAA
ACTATGCTAAAAGATCAATTAAAAAGAAGTTCAATCAAATTAATTTAGATAATTATTTAG
ATTTTAAGCAAAAAAAAAAATTGATTTAAAGTTTTAATGATTTCAAAAAGCACACTCAAT
AAGAAATTAGATTGAAAAAATTAGTTATTAATTTTAGGATAAACTAAAAATTTAAGATTT
ATCGTATATTCTTGAATGCTTTAGCAAGGGAAAATATCCTTAAGCAAAAATAGATTTTAT
ATCAAATGAACCATGAATTAAAGCTGAATGAAACAAATATAAATTCTAGCTCTGAAGTTA
TTCGTTCTTATGAAAACGAAAAATAGAATTTAATTTATGAAATTAATTAGTTAAAAGAAG
AAAATTTTGGCTAAAAACTAGCTATTGAAGAGTTTTAGCAAATTCAGATTAAATGTAACT
CTTAATTAAGATCAATTGAGAGATAAGAAAAAATATTTAAAGAAGAAAAAGAAGCTTATG
AGTTAAGAATAAGGGATTATGAAGAATTGCTTAAATAAATCCATTCAGAATATTAAAAAT
AAATTCATTAAAAAGACATAGAAATTCATGAGTCTAAAAATGAAACCAGAGCCGTCTAAA
AGTAAATATCTATCCTCCAAAGAGAGCTTGAATGTAATATTTTTTTAATTTAAAATATTT
TTTGAGATTTTAAAGTTCGGAATAAAACTGATTTTTCAAAATAGTATTAAGAAGAAAAGT
AGAAAAATTATATATTTTTTTTATGAAAAATTTATTTAAAAATAATAAATTATTTTATTT
TATTAAAGTTAAATAAAATACTATTTTGGAAACTGAAAAAGCTTTACTTAATAGAGGAGA
ATAATCCTCTATACTTCTGAGAGAGACAGAAAAAAAATTATAGAATTCAATAATGATGGC
TAATGAGTTTAAAACTAAAATTGAAGAATTGTATTCAGAAGTAAAATTGAATTGTTTATT
TGATTTTTAAAATTAACTTAATTTTTTGAAATTAGAATGAAGAATTAAAAGATTAAGTAT
ATGGAAAAGATTTGGACATTGAATAATTGAAATCTAAATTAAAAGAAAGTTTAGATTTAA
TCAGAGAGTCTTCTGACATGTATGATTAAAAAATAAATGACTTCAATGCAATTATTGAAA
GCAAGAATACACAAATATAGGAATTTATAGACAAGCAAATCCGATTCTAAGAATAAATTA
ATGAACTTTAACAAGAATTAAGGAAATAACATTTAGAACTAGAACTATTTTAGGATATAC
AGCCAATGCTCGAACATCCTCAAGTGAATTAATATTGTAAAATATTTAGTTTTAAATGGA
ATTTTAACATTTTTTAAAATAATATTTAAGATTAAGAATACTAAGATCTTTAGAACGAGC
TTGATACTTAGAGAAATAATTTGAAGAAGAGAATGGATAAACTAAATAGAAGCATTAATT
AGATTTAAGATATTGATAGAAGAGTTAAGAATTAGACATTAAGAGACTAAAATTAATGTA
AAAAAATAAATGCTTAGTTTCAAATATTTAAAATTAATATTTATATTTTAAGAATATGAA
AGGACAAGTCCGCTCTATAGCAGATAGGGTTCTCCAATGAGTGAAAGGATTATAAAGGAA
TAAGAAAATACTGGAAATGTTTTAAGAAATAGTGGAATTAGCACTATTAAAAGCTACTAG
CCTTAATCCGAAATGCAAGTTAATTTTAGAAGTGTGGACACCTTTTCTAATTTTCACAAT
CAGAGTTATCACAATACTTATAATCTACATTCTGTCGAGGATGTTCATACAGCTCCTGCA
TAAAGAATTCACACAGACCCTTCTAATGCTAGAGAAGCTCATTATTAAGTAGAAAGAAAT
GCCTTAACAAGAGCAAGTTATGATCCTTACAATCGCTTTGGTGAAGAAAATTTTGCTACT
TACGAAGACTGTGAAACAGCTGAATAAATTCATGAAGAGTATTTAATAAAAAAACAAATA
TATATTTAAAAATATTTTTATAATAGGTTAGAAAGAAACAAAGCTAACAGAAAGTTATTT
AAGCAAAATATAGAAAGAAGGATAAGCAGATTAGAAAACAATATCGATAGAGATTTAGCA
TAAAACGAAAGAAATAAATCAAGGTCTTAATCCCCAGAAAACTACTACGTATAAAACTGA