Identifiers and Description

Gene Model Identifier

TTHERM_00058810

Standard Name

SFR7 (Sfi1 repeat protein)

Aliases

PreTt13066 | 4.m00465 | 3707.m00110

Description

basal body and macronuclear localization; predicted to have 16 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08514 ) STAG domain
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( TIGR00162 ) conserved hypothetical protein TIGR00162

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00058810

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_01986.19.997093137033517e-262hypothetical protein (602 aa)
OxytrichaContig761.1.g410.0004999512321494991Tetratricopeptide repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00058810(coding)
ATGAATGAAGGAGAAGTTAACGATTAGGATGAAGAGGGAATCATTTATTGGAATAAGAAA
GTTATCAAGAAAGCATTTAATGAGTGGAAGTAAAGGCTAAATAATAAAAAAGATATGTTC
AGAAAATTAGTTATAGCCCGTTACGAAATAGAATTTAAAAGAAAGAAGAAAATATTTGAT
TATTTATAATATAACAAGTCTTATTCCTACAATATGAGGATTCTTTTAATGGAATAGTCA
GCAAGAATTAATCAAAAGCTTAAAGAGAAAGTTTTTAAAGGGTTTTAAAGTATAAAATAA
AAGAAAGAGGTCAGATCCGAATTTTTTGCTAAGATTTGCTACTTCTATCATGATTTCATC
CTTCACAAGTACTTTAATATAATGAAAAATTAGAAAGAACTGATTTGGGAGTAGGACTTT
TAAAAACAAAAAGCAAATATATTTTGGAAGTAAAGTCTTTAAAGAAAGTATTTTTTGTGT
TTGAAGTAAGCAAAAATTATGAAGCTTTAAATTGACAGAGAAATATAAAAGAAGATAAAC
ATTTGTAAGCTCATATTTAAGAAGACTCATGCTAGAATTTTTATTAAGAATCTAAAAGAA
AATGTCGATCATAGAATATAGATTAAATAGTAATTTAAATAACTGGCGAATGCTAAGATG
AAAATCTATTTTGATAAGCTTAAAAATTATTTGGTAAAGTAATAAATAAAATAAAAAAGA
TTATAATTAGCTGATAGCTATCAATAAAATAGAGTAGGAAATTTAATCAAACAAAAATAT
TTTAACTTGTTGTAAAAGATTGTAAAAGATTGCTAGGATTTTAAAAGAAAATAAATCCTC
ATTAAAAAGAAAATGCTAAAAAAATATTTCAATTCTTTTGTGTCATAATTAGAATATAAC
TTTAATGTAAATATTTACTATGCTGATAAGCATTTTGAATAAAAGCTAGCTAAAAAATTT
TTCACTGCTCTAAAGCTCTATTAGAAAATCGTGCATTATCATAAAATAAAAAATTAAAGA
AAAATAAAATATTTAGTTAAAGATATCTTCAACTCATTTAAAAGTTATTGGTAAAGATGC
TAATTAGAGACTAAAAAGCGCTACTTAATTACTAGGTCTAGACAGAAATTTGTCAAACAG
TTTGTGTGGAGATAATGGAGAGATTAATTACTGCTAAAGCAAGCTGAAGGAGAGAAACAA
AAAGATATTTAATAAATTTCGAACAAATAGTATTTGAAGAAATCATTTTAGATACTAAAA
AATTATTAAATTAATTAATAAGTTAAGAAAAAATAGAAAAAAATAATAAACAAACATTTA
CTTCATAAATATTTTTAACTAGTTGTTAAGTTTTATTTAAGAAAAAAGTCTGTATAAGAA
AAAGAGAGGCAGGCAAGGAAATTTTACTTCATAAAATCAGTAAAATAAGGTTTTTATGAA
ATGAAAAGAGTTTATTTAATTAAAAAAAATATAGTTCTCAAAATATAATAAAAAGAATAA
CAAAATAACATTTTGTTGGCTAAATAATCATTTTAAATATTACTTTAAAATAAAGCAAAC
AAATAGAAAAAGAAAGCTAAATACTAGAACTTTTTAAATAAGAATGTAAATAAATAGCAA
CTTTAAATATTTAATGCTTTTAAACTATACTCCAAATCTAAAATCTTTAAAAAAATAGAC
TAACAAAAGCATTAAAAAAATATTTAAAGCGGACTTTTGTAAAGAATTTTACAATCATGG
AAAAACATAATTTGCCTAAAAAAAAATAAAAGAACTTATTTTTAAGAAAAGTCAACTTTG
ATAGCCAAAAAAATTGCATTTAAGAGATTTGAGAAAAATGTACAGGAATAAAGAATAATT
AAAAGAAAGTTAAGAGCTTTGAAACTAAAAAAAATGATTAAAATGAAAAAGCTAATATTC
ACTCATATGAAATAATTTTTATGGAAGAAGTAAATAAAAAAACAGGAAATAAAGGAAAAG
GAGAATCTATACCTAGCTAAACTATTGATAAAATCTCTATTTGCATGGAAACTCTACCTA
AAAGCTCTTAGGAGAGCTAAATAGAAAGTTAAGTATGCTATTGTTCATTGGTCAAACCAG
AAAAAAAAAATTTCTTTCAAAAAAATGTAAGAGTTTTTGTAAATAAAGAAATAAAAAAGA
TAAGAAGAACTAGATGCATTTAGTTTACACATTTCTCATAAATAGAATGAAGTTTTGAAA
AAAGTTATTATGATGGGAATCGAAATCAAAGAAAGTAAGATCAAATTCTAAAAGAATGAT
TTAGTTAAAATAAAAATAAGGGAATAAGATTTAGCCTTTAAGTATGGTAGAAAATGGCTA
GATTTTTATGAAAGAAGGAAAATCTTAAAAAAATAATTAAATTGTTAAAATTAAAACAAG
TAGTAGATTTAATAGCAGAAAGGTTTATAAAACATAAAAGCTTAGTAACCAAAAGACACT
ATTGTTTTTGATAGAAGTAATAAAAGATAGCATGCCTATTAAATGAGTTTTTTCCCAAAT
CATTAGCTAAGCAAGGAGTCATTTCAAAATGATTCTATAAATATTTAATAGTAAAATAAA
GTTTTCTTTTAATAAAATACACCAAATAAACCACCATCCTCTTAAGGAAACCCAACATTC
AGATAAGGATCTGAAGACAAAGCCAAAGAGATTCTAAATTGGTTTGATAAAGAGTTTTTG
GTTAAGAATAAATTGGTCCCTAAAAAAATATAAGAAAATTAATAAAACTAAGATACAATT
CAAATCCAGCGAATAGGTGTAAATGTAAAACAAAATAATAATAAAATCACCTAAGAAAAT
GTAACTACAGCTAAATAGCAAATATTCTCTTAAAACTAAAAATAAAGTAATAACATATTT
AATCAGTTAAATGAAATACCAGTTGAAGCACCAAAGAGTTAAAAAAATAATTCTGGATAT
TTTTAAAATTAGTCTAACTAGTAAATTAAAGTACGTAATAGTTTGCTAAATGTACAGTAA
AATTCTAATCATGTTCTTCATTTGAGTAACATAGCTTAGCTCCTTGATTAAGATCACTCT
ACAACTATTATTGAAGATATTAAAGAAAAAAATAAATAATTAGAATAAATTATTGCTGAA
TACTAAAATAAAAAGCAATAGGGTAATAATGTAAGAGCATCAGAATTAAAAGCATTAATA
TAAGAAAAGCTTTTAGAAATTAAACAATTAAAAAGCAACATATGA


>TTHERM_00058810(protein)
MNEGEVNDQDEEGIIYWNKKVIKKAFNEWKQRLNNKKDMFRKLVIARYEIEFKRKKKIFD
YLQYNKSYSYNMRILLMEQSARINQKLKEKVFKGFQSIKQKKEVRSEFFAKICYFYHDFI
LHKYFNIMKNQKELIWEQDFQKQKANIFWKQSLQRKYFLCLKQAKIMKLQIDREIQKKIN
ICKLIFKKTHARIFIKNLKENVDHRIQIKQQFKQLANAKMKIYFDKLKNYLVKQQIKQKR
LQLADSYQQNRVGNLIKQKYFNLLQKIVKDCQDFKRKQILIKKKMLKKYFNSFVSQLEYN
FNVNIYYADKHFEQKLAKKFFTALKLYQKIVHYHKIKNQRKIKYLVKDIFNSFKSYWQRC
QLETKKRYLITRSRQKFVKQFVWRQWRDQLLLKQAEGEKQKDIQQISNKQYLKKSFQILK
NYQINQQVKKKQKKIINKHLLHKYFQLVVKFYLRKKSVQEKERQARKFYFIKSVKQGFYE
MKRVYLIKKNIVLKIQQKEQQNNILLAKQSFQILLQNKANKQKKKAKYQNFLNKNVNKQQ
LQIFNAFKLYSKSKIFKKIDQQKHQKNIQSGLLQRILQSWKNIICLKKNKRTYFQEKSTL
IAKKIAFKRFEKNVQEQRIIKRKLRALKLKKMIKMKKLIFTHMKQFLWKKQIKKQEIKEK
ENLYLAKLLIKSLFAWKLYLKALRRAKQKVKYAIVHWSNQKKKISFKKMQEFLQIKKQKR
QEELDAFSLHISHKQNEVLKKVIMMGIEIKESKIKFQKNDLVKIKIREQDLAFKYGRKWL
DFYERRKILKKQLNCQNQNKQQIQQQKGLQNIKAQQPKDTIVFDRSNKRQHAYQMSFFPN
HQLSKESFQNDSINIQQQNKVFFQQNTPNKPPSSQGNPTFRQGSEDKAKEILNWFDKEFL
VKNKLVPKKIQENQQNQDTIQIQRIGVNVKQNNNKITQENVTTAKQQIFSQNQKQSNNIF
NQLNEIPVEAPKSQKNNSGYFQNQSNQQIKVRNSLLNVQQNSNHVLHLSNIAQLLDQDHS
TTIIEDIKEKNKQLEQIIAEYQNKKQQGNNVRASELKALIQEKLLEIKQLKSNI


>TTHERM_00058810(gene)
ATGAATGAAGGAGAAGTTAACGATTAGGATGAAGAGGGAATCATTTATTGGAATAAGAAA
GTTATCAAGAAAGCATTTAATGAGTGGAAGTAAAGGCTAAATAATAAAAAAGTAGATTGT
TTAAAATTTTTGTAGTATATCATAAATATATAAATCATATTATAGGATATGTTCAGAAAA
TTAGTTATAGCCCGTTACGAAATAGAATTTAAAAGAAAGAAGAAAATATTTGATTATTTA
TAATATAACAAGTCTTATTCCTACAATATGAGGTATTATTCATTTTTGTTAATAAAAATA
ATTAATTTTCATTAATGTTAGGATTCTTTTAATGGAATAGTCAGCAAGAATTAATCAAAA
GCTTAAAGAGAAAGTTTTTAAAGGGTTTTAAAGTATAAAATAAAAGAAAGAGGTCAGATC
CGAATTTTTTGCTAAGATTTGCTACTTCTATCATGATTTCATCCTTCACAAGTACTTTAA
TATAATGAAAAATTAGAAAGAACTGATTTGGGAGTAGGACTTTTAAAAACAAAAAGCAAA
TATATTTTGGAAGTAAAGTCTTTAAAGAAAGTATTTTTTGTGTTTGAAGTAAGCAAAAAT
TATGAAGCTTTAAATTGACAGAGAAATATAAAAGAAGATAAACATTTGTAAGCTCATATT
TAAGAAGACTCATGCTAGAATTTTTATTAAGAATCTAAAAGAAAATGTCGATCATAGAAT
ATAGATTAAATAGTAATTTAAATAACTGGCGAATGCTAAGATGAAAATCTATTTTGATAA
GCTTAAAAATTATTTGGTAAAGTAATAAATAAAATAAAAAAGATTATAATTAGCTGATAG
CTATCAATAAAATAGAGTAGGAAATTTAATCAAACAAAAATATTTTAACTTGTTGTAAAA
GATTGTAAAAGATTGCTAGGATTTTAAAAGAAAATAAATCCTCATTAAAAAGAAAATGCT
AAAAAAATATTTCAATTCTTTTGTGTCATAATTAGAATATAACTTTAATGTAAATATTTA
CTATGCTGATAAGCATTTTGAATAAAAGCTAGCTAAAAAATTTTTCACTGCTCTAAAGCT
CTATTAGAAAATCGTGCATTATCATAAAATAAAAAATTAAAGAAAAATAAAATATTTAGT
TAAAGATATCTTCAACTCATTTAAAAGTTATTGGTAAAGATGCTAATTAGAGACTAAAAA
GCGCTACTTAATTACTAGGTCTAGACAGAAATTTGTCAAACAGTTTGTGTGGAGATAATG
GAGAGATTAATTACTGCTAAAGCAAGCTGAAGGAGAGAAACAAAAAGATATTTAATAAAT
TTCGAACAAATAGTATTTGAAGAAATCATTTTAGATACTAAAAAATTATTAAATTAATTA
ATAAGTTAAGAAAAAATAGAAAAAAATAATAAACAAACATTTACTTCATAAATATTTTTA
ACTAGTTGTTAAGTTTTATTTAAGAAAAAAGTCTGTATAAGAAAAAGAGAGGCAGGCAAG
GAAATTTTACTTCATAAAATCAGTAAAATAAGGTTTTTATGAAATGAAAAGAGTTTATTT
AATTAAAAAAAATATAGTTCTCAAAATATAATAAAAAGAATAACAAAATAACATTTTGTT
GGCTAAATAATCATTTTAAATATTACTTTAAAATAAAGCAAACAAATAGAAAAAGAAAGC
TAAATACTAGAACTTTTTAAATAAGAATGTAAATAAATAGCAACTTTAAATATTTAATGC
TTTTAAACTATACTCCAAATCTAAAATCTTTAAAAAAATAGACTAACAAAAGCATTAAAA
AAATATTTAAAGCGGACTTTTGTAAAGAATTTTACAATCATGGAAAAACATAATTTGCCT
AAAAAAAAATAAAAGAACTTATTTTTAAGAAAAGTCAACTTTGATAGCCAAAAAAATTGC
ATTTAAGAGATTTGAGAAAAATGTACAGGAATAAAGAATAATTAAAAGAAAGTTAAGAGC
TTTGAAACTAAAAAAAATGATTAAAATGAAAAAGCTAATATTCACTCATATGAAATAATT
TTTATGGAAGAAGTAAATAAAAAAACAGGAAATAAAGGAAAAGGAGAATCTATACCTAGC
TAAACTATTGATAAAATCTCTATTTGCATGGAAACTCTACCTAAAAGCTGTAATTTAATT
AATATAATTATTTATTAAAAATATTTTAAAATAGCTTAGGAGAGCTAAATAGAAAGTTAA
GTATGCTATTGTTCATTGGTCAAACCAGAAAAAAAAAATTTCTTTCAAAAAAATGTAAGA
GTTTTTGTAAATAAAGAAATAAAAAAGATAAGAAGAACTAGATGCATTTAGTTTACACAT
TTCTCATAAATAGAATGAAGGTATTTTTATTATCTTTTTTTATTCAAACTGTTATTTATT
TTTTATCAGTTTTGAAAAAAGTTATTATGATGGGAATCGAAATCAAAGAAAGTAAGATCA
AATTCTAAAAGAATGATTTAGTTAAAATAAAAATAAGGGAATAAGATTTAGCCTTTAAGT
ATGGTAGAAAATGGCTAGATTTTTATGAAAGAAGGAAAATCTTAAAAAAATAATTAAATT
GTTAAAATTAAAACAAGTAGTAGATTTAATAGCAGAAAGGTTTATAAAACATAAAAGCTT
AGTAACCAAAAGACACTATTGTTTTTGATAGAAGTAATAAAAGATAGCATGCCTATTAAA
TGAGTTTTTTCCCAAATCATTAGCTAAGCAAGGAGTCATTTCAAAATGATTCTATAAATA
TTTAATAGTAAAATAAAGTTTTCTTTTAATAAAATACACCAAATAAACCACCATCCTCTT
AAGGAAACCCAACATTCAGATAAGGATCTGAAGACAAAGCCAAAGAGATTCTAAATTGGT
TTGATAAAGAGTTTTTGGTTAAGAATAAATTGGTCCCTAAAAAAATATAAGAAAATTAAT
AAAACTAAGATACAATTCAAATCCAGCGAATAGGTGTAAATGTAAAACAAAATAATAATA
AAATCACCTAAGAAAATGTAACTACAGCTAAATAGCAAATATTCTCTTAAAACTAAAAAT
AAAGTAATAACATATTTAATCAGTTAAATGAAATACCAGTTGAAGCACCAAAGAGTTAAA
AAAATAATTCTGGATATTTTTAAAATTAGTCTAACTAGTAAATTAAAGTACGTAATAGTT
TGCTAAATGTACAGTAAAATTCTAATCATGTTCTTCATTTGAGTAACATAGCTTAGCTCC
TTGATTAAGATCACTCTACAACTATTATTGAAGATATTAAAGAAAAAAATAAATAATTAG
AATAAATTATTGCTGAATACTAAAATAAAAAGCAATAGGGTAATAATGTAAGAGCATCAG
AATTAAAAGCATTAATATAAGAAAAGCTTTTAGAAATTAAACAATTAAAAAGCAACATAT
GA