Identifiers and Description

Gene Model Identifier

TTHERM_00547950

Standard Name

SFR6 (Sfi1 Repeat containing protein)

Aliases

PreTt15047 | 71.m00174 | 3729.m00051

Description

cortical row basal body localization; predicted to have 12 Sfi1 repeats; Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00467 ) KOW motif
  • ( PF01920 ) Prefoldin subunit
  • ( PF07989 ) Spindle associated
  • ( PF00560 ) Leucine Rich Repeat
  • ( PF08182 ) Pedibin/Hym-346 family
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( TIGR02413 ) Bacillus tandem small hypothetical proetin
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00547950

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17049.19.997093137033517e-262hypothetical protein (1041 aa)
WormBaseWBGene000173200.0000000010002658722841845Uncharacterized protein F09G8.
5 status:Partially_confirmed
UniProt:P34390 protein_id
:CCD62650.1
DictyBaseDDB_G02841010.00000030014504373857585snrpA1 on chromosome: 4 positi
on 1571395 to 1572487
SGDYPL169C0.000009999254677478949MEX67 Poly(A)RNA binding prote
in involved in nuclear mRNA ex
port, component of the nuclear
pore; ortholog of human TAP

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00547950(coding)
ATGAGTCTACATAACTCTAAACAATACATTTCCAGTAAAAGCCCTTTCAAAGGCCCATTT
CCACTTTCTTAGTTCCTTGAAGAAAGACATTAAGATATATAAGGAAACCATTTAGTGTTT
TAAAATCACAATATCGATGAAATTGATGAGCTCTACATGGATATGTCAAAAATAAGATCT
ATTGATCTCTCATCAAACAGACTCAAATCTCTAAAAGGGATTCAACAATTTTAAGATTTA
AGAAACTTAAATATTTCAAATAACTAAATTTCAGATGTAAGCGAACTTTTCTATCTTAAA
GAGTTGCAGAATTTATAGATCCTAAATTTGAATAACAATCCAGTTGTTTAATAATAAAAC
TACAAACTCACTTTAATGACTATTCTACCTAAATTATAGGTTTTAGATAGTAAAAAATTA
TCTTAGACAGATGTAGAAGAAAATACAAGATAAGTCAAGTTTATGAACAACTAACTGAAT
TTACTTTATGAGAATTATTTGAAAATAGTGGAATTACAATCTATAATTTAAAGATTGCTG
ACACATAAAGAATATATATTCACCTTTGAACCTAATGTTATGAATCCACCATTTAATTTG
TAGAAATTTAGGAAAATTTTTAGCTATGGAGATACTATAGATGAAAAAGCTTAATAAGAA
ATCAAAACAAATTTATTAGCTGACGTTTAAACAATTTAAAATGAAATATTGAAAACTTAA
AAAATAGAAGAAGCATTTGCAGAAATGGAAAGGAGATAGATTGATAAAATCTAGTAATTA
GAGAATACTGTGCTATAAAAAGTTAAAGAGTACAAATACAACTGTCTCGATATTGAGATT
TTCCATAAGCTGAATAAAAATAATACCAAAATACAGAACTTAAAAAAATTTATAAACTTT
ACAAGATAAGAGTAGAAATAAGAAGTAGTTGTAGTAGGTAATAAAGGGAAAATATAAAGA
AATAGAAAAGATCAATAAAATATTTATGTTGAAGATAGCTAAAGTAGTTAGTCTTAATAG
AATAAAAACGAATAAGGTTAAATTTAATAAGATTTTTAAACAGATGAAAGCTTAAGAGGA
TCTTTTTAAAATTAAACTTTTACTGAAAGAGACCTGAAAAGATTAGCGAACATAAATAGG
GATAAATCTGATTCAAATATGAGTGAAATGAATGTCAGAAATATGTCAGAGGAGGAAAAA
GAACTTCTTATAGAGAAATTAGCTGGTTCTTTGAAAAAATATATAGGAAAATCAAAAGAA
TTTGAGAAATAGTATGAAAAGGCTTTACTGCAATCTTCTAATGATCAAGAAATGCTCAGA
AAAAAAGAAGAAGAGTTAAATTGTATTATGGAATTACAACAATAAATCAAGCAAAAACTT
GAAGATTACGGAGTGCAAAATATAGATGAGTGCTTTTAAACTCTTTAAACATAGTTGGAA
TAAATCAAAGAACTCAGATAACTACTTGAATAGCAATAAATTGAAGAGGAAAACACACTA
AAAGCAGATTACTTTTCTAATCAAAGATTAATGCAAAGATCTTTAGGATAATTGTATTTC
TAAACAAAAAAAAATAAAATGGTGAAAACTGTTGTTGAAAAGAGCAATAAATACAGAAAT
CTAAAAATTCTAAAATTATATCTCAGTCATTGGAAATAATACCATGTTTTTTCAAAAATA
AGAAAAACAAAATAAGAAGACTTGCTTTAGAGAGTTTATGTTGGCTGTTTTTTTGCTTTA
AAGTTTAATGTAAATAGGAAAAAAGCATTAAAATAATTCTAAGAAAAATTCGAAAAAGGA
TTAGCAGAAAAAGCATTTAGGAGTTTGTTTATATTTTTAGTTTCTAAAAAAAGAGAGAAG
CAGGATGAAATTGCTGCAGATGAGAAATACTCTTTTCTACTTTTGAAGAAAGGTTTCCAA
TCACTCTTTTATAATCATCTGCAACATTCAAATAGGAGAGATCCATTATATGAATAAAAA
ATGTAAATTGCAGAGGACTCTAACATTAAATAAATTTAAATCAAAGTTCTTTCTCGTTTT
CGAGATGCATGTGAAAATTAAAAGTACAATAAAAAGAAAGTTATAGCCATGACTTAAAGA
ATACAATGGGCAATGCTTAAGTATAATTTTAGAGAGTTTAAGCTTGAAGATATCAGAATG
AAGAAATTAACTAGCAGAGCAGACAAGTTTTTAGGAAGAAGATAAAAGTATTGGCTTAGG
GAAGCATTTAATGCATGGAAAGTTGATTTTCATAATTATTTATATGAAAAATAATAAGTA
AACATGCAAATCTCAAAGTTTTAATTGTAAAGTGTTTTTAATACATTTAAGAGAGGATAT
AAAATGTCTTGTCAGCAAACTGCAAACATATAAAATTATTAGAGAAGAAAAGACTTGCTC
TTATACAGCCAATATTTTGCAATAATTAAAAAGTTTTCTAAATAATAAATCAAAGTAAAG
CAATTTGCTAAAAATTACAATACCAAAAAACAGCAATAATCTTTAAAATAATCGCTTTAA
TGCATGAAAATACATACTTAACTGGTAAAAGAGAAAAAAATACTTGACAAAAAAGTTAAA
AAAATAATATTCACAAAAGTTATACAAAATTTAAGGTAAGTTTAAAATACCAAAGTCCTT
TAAAAGTAAAAATTGAAAAATGTCTTCAAGATCTAAAATTCTTAAAAGATATTCTTAATT
AAATAAGCCTTAAAAAAATGGAACAAAGAAGCTAATAGAGACAGAAAGCTTGAAAGTGCT
TTGAAATTCTATTAAAAAAATCAATATTAAAAACAAGGCTACTAATTTATATCTAATTTA
TTACAAAATGGGAATAAACTGAAAAAGTAGCTGAACAATCAGCTTGATGAAAAAAACATT
CAACTAATGAGGGAGAATTAATACCTAAATGAATAATTAATAGAATAACAAAAGCAAATC
TATTTAATTAATGAGGAATATTAATAGCAGGTAGTTAAATCAGAATAACTTGCAAAATAT
AACCTAGAGAAAGATGTTTTAATTTAGCAATTAATCAAGTAAAATAATGATCTCAAAGAG
ATTAACATCCAACTGACAGAAGTTGCTGAGAAAAGAGAAGAAAACAATTAGAATTTGGAG
AGCAACTTAAACATCATCTAAGACGAATACGAGTAGCAGATTAGAAACTTAAAGAATGTC
TAAATCTAATTCGATAAAGAAAGAGATCTGCTAAATAGCAATATCTAAAATTTAAATATT
GAGCTCAATGCAAAAATAGAAGAAATAAGTGAGTTTAAAAGCATAACAGCAGCAAAGAAT
GAAGATTTTTACTAAGAAATAACCCAACTAAAGAACAAAATTTTAGCTTAAGATAAAATA
ATTGCAGAATACGAAGAGATGACAAAAAGCTTGTCAAATACAAACAAAGAAGTAGAGAGC
TTAAACATTCATCTGAATGTAAGGGTAGAGTCTTTGCAAGAAAGAATTTCAAATTTGCAA
AAAGAATCAGCTATGCAAGTTTCTTCACTTGAGAAGTAGTTAGAATTTGCTAACAGAGAG
AGATCAAACTTGATTGCACAAAACACTTCTCTGATGAATTAAAATAAAACTTTTTAAGCA
GAATTAAATCAGCTAAATCAAAACCTAAAAAAAGAGGAGTTTAAAGTCTCTCTTCTCAGA
GAGTAAGATTATGACAAAACTTCGTAATTTATACAGTTGGCCAAAAATATTAATTCACCT
AGCAGAAAACAAGCATCGTCTCCATTAAGATTTACTGGAAGACTAAAAACTCTTCCTGAA
GATTCTTTGATAGATGAAAGAGTTCTCAATACATCTCATTCAAGAATAAACACATTAATA
CAATAAAAAACAGACAGAAATTTATTCACTTAACCAATTACTTAGGAAAATGGAATTTAA
AATCCAAATAACAATTCTATATCATAATTTTTCTCCCATAAGGTTCCCCAAATGAATCAA
ACTTAACATAATTCTATAAAAAAAGAAGTCTCTCCTTTGAGGGAATATCTAACTGACATG
AAATTCAGGGCCTCAGTGTTTATAAAAACAATTGACATGGATGAAAAAAATAAAAAAAGC
ATAAGAAACTCACCATAAAAAGGCTGTATTTCCCCTTAAAAGACCTCATCACCACAGCTA
TATAAAAGCCAAAGAAATTTATAGAATCAATCACAAACAAGTGTGATAAAAGATGAAATT
CAAAGAAGATTGAACAATTTAGACTATAAATTTAATGAGGATATCAAAAAATTTTAATCT
TAGCAATAGCAGTGA


>TTHERM_00547950(protein)
MSLHNSKQYISSKSPFKGPFPLSQFLEERHQDIQGNHLVFQNHNIDEIDELYMDMSKIRS
IDLSSNRLKSLKGIQQFQDLRNLNISNNQISDVSELFYLKELQNLQILNLNNNPVVQQQN
YKLTLMTILPKLQVLDSKKLSQTDVEENTRQVKFMNNQLNLLYENYLKIVELQSIIQRLL
THKEYIFTFEPNVMNPPFNLQKFRKIFSYGDTIDEKAQQEIKTNLLADVQTIQNEILKTQ
KIEEAFAEMERRQIDKIQQLENTVLQKVKEYKYNCLDIEIFHKLNKNNTKIQNLKKFINF
TRQEQKQEVVVVGNKGKIQRNRKDQQNIYVEDSQSSQSQQNKNEQGQIQQDFQTDESLRG
SFQNQTFTERDLKRLANINRDKSDSNMSEMNVRNMSEEEKELLIEKLAGSLKKYIGKSKE
FEKQYEKALLQSSNDQEMLRKKEEELNCIMELQQQIKQKLEDYGVQNIDECFQTLQTQLE
QIKELRQLLEQQQIEEENTLKADYFSNQRLMQRSLGQLYFQTKKNKMVKTVVEKSNKYRN
LKILKLYLSHWKQYHVFSKIRKTKQEDLLQRVYVGCFFALKFNVNRKKALKQFQEKFEKG
LAEKAFRSLFIFLVSKKREKQDEIAADEKYSFLLLKKGFQSLFYNHLQHSNRRDPLYEQK
MQIAEDSNIKQIQIKVLSRFRDACENQKYNKKKVIAMTQRIQWAMLKYNFREFKLEDIRM
KKLTSRADKFLGRRQKYWLREAFNAWKVDFHNYLYEKQQVNMQISKFQLQSVFNTFKRGY
KMSCQQTANIQNYQRRKDLLLYSQYFAIIKKFSKQQIKVKQFAKNYNTKKQQQSLKQSLQ
CMKIHTQLVKEKKILDKKVKKIIFTKVIQNLRQVQNTKVLQKQKLKNVFKIQNSQKIFLI
KQALKKWNKEANRDRKLESALKFYQKNQYQKQGYQFISNLLQNGNKLKKQLNNQLDEKNI
QLMRENQYLNEQLIEQQKQIYLINEEYQQQVVKSEQLAKYNLEKDVLIQQLIKQNNDLKE
INIQLTEVAEKREENNQNLESNLNIIQDEYEQQIRNLKNVQIQFDKERDLLNSNIQNLNI
ELNAKIEEISEFKSITAAKNEDFYQEITQLKNKILAQDKIIAEYEEMTKSLSNTNKEVES
LNIHLNVRVESLQERISNLQKESAMQVSSLEKQLEFANRERSNLIAQNTSLMNQNKTFQA
ELNQLNQNLKKEEFKVSLLREQDYDKTSQFIQLAKNINSPSRKQASSPLRFTGRLKTLPE
DSLIDERVLNTSHSRINTLIQQKTDRNLFTQPITQENGIQNPNNNSISQFFSHKVPQMNQ
TQHNSIKKEVSPLREYLTDMKFRASVFIKTIDMDEKNKKSIRNSPQKGCISPQKTSSPQL
YKSQRNLQNQSQTSVIKDEIQRRLNNLDYKFNEDIKKFQSQQQQ


>TTHERM_00547950(gene)
ATGAGTCTACATAACTCTAAACAATACGTAAGGAATTTTTATAAATATTCATTAAATAAT
TGTATTCATTTTATTTTAACTTACTATTTTATAGATTTCCAGTAAAAGCCCTTTCAAAGG
CCCATTTCCAGTATGATTTATTAATGATGTTGAAGATAAATTAAAGACTTTGCTAAAAAA
TTATTAAAATAGCTTTCTTAGTTCCTTGAAGAAAGACATTAAGATATATAAGGAAACCAT
TTAGTGTTTTAAAATCACAATATCGATGAAATTGATGAGCTCTACATGGATATGTCAAAA
ATAAGATCTATTGATCTCTCATCAAACAGACTCAAATCTCTAAAAGGGATTCAACAATTT
TAAGATTTAAGAAACTTAAATATTTCAAATAACTAAGTACATTTTACAAAAGAAAACCAA
TAGCTATTGATTGATTCATTTATATTTATTTTATTATAGATTTCAGATGTAAGCGAACTT
TTCTATCTTAAAGAGTTGCAGAATTTATAGATCCTAAATTTGAATAACAATCCAGTTGTT
TAATAATAAAACTACAAACTCACTTTAATGACTATTCTACCTAAATTATAGGTTTTAGAT
AGTAAAGTAAATATTTAAATTTAGAGATATAATTTAACATTTTATATTAGATACAATTAA
TTAATTGTGATTTTTTATTTTTATAAAAAGAAATTATCTTAGACAGATGTAGAAGAAAAT
ACAAGATAAGTCAAGTTTATGAACAACTAACTGAATTTACTTTATGAGAATTATTTGAAA
ATAGTGGAATTACAATCTGTAAGCAAAGTTTTTTAGATAAAAATAGAAAATATTTTAAAA
ATTAATTATAAGTTTTATATTAAAAAGATATTATTAAATCTTAAATAAATTTAATAAAAT
TTCAAAAGATAATTTAAAGATTGCTGACACATAAAGAATATATATTCACCTTTGAACCTA
ATGTTATGAATCCACCATTTAATTTGTAGAAATTTAGGAAAATTTTTAGCTATGGAGATA
CTATAGATGAAAAAGCTTAATAAGAAATCAAAACAAATTTATTAGCTGACGTTTAAACAA
TTTAAAATGAAATATTGAAAACGTAGGACTTTATTTTTTTTAAAACTCTTGTTTTTTAAA
TAAATTATTTAGTTAAAAAATAGAAGAAGCATTTGCAGAAATGGAAAGGAGATAGATTGA
TAAAATCTAGTAATTAGAGAATACTGTGCTATAAAAAGTTAAAGAGTACAAATACAACTG
TCTCGATATTGAGATTTTCCATAAGCTGAATAAAAATAATACCAAAATACAGAACTTAAA
AGTAAATTAAAATTAATATTTTATTTACCAAAACTAACACTCTAAAGAAGCTATTGATAT
TTGCTAGATTAAAAGCTGTTTAAAATAGATTTTAGAATATTTAGGATTTTATTCAATATC
TTATTAATTTTAGAAAAGAATTATAAAATTAATATTTAATTATTTACCAAAATTAACACT
CTAAAGTTTATTCAATATCTTATTAATTTTAGAAAAAAAGGATTTTATTCAATATTTTTT
TAACTTTAGAAAAGAATTATAAAAATAATTATTTAATATAGAAATTTATAAACTTTACAA
GATAAGAGTAGAAATAAGAAGTAGTTGTAGTAGGTAATAAAGGGAAAATATAAAGAAATA
GAAAAGATCAATAAAATATTTATGTTGAAGATAGCTAAAGTAGTTAGTCTTAATAGAATA
AAAACGAATAAGGTTAAATTTAATAAGATTTTTAAACAGATGAAAGCTTAAGAGGATCTT
TTTAAAATTAAACTTTTACTGAAAGAGACCTGAAAAGATTAGCGAACATAAATAGTAAAT
GGATTTAAGTTGGCTGTGTTTAAGTTTTTTTTAATTGAATAGGGGATAAATCTGATTCAA
ATATGAGTGAAATGAATGTCAGAAATATGTCAGAGGAGGAAAAAGAACTTCTTATAGAGA
AATTAGCTGGTTCTTTGAAAAAATATATAGGAAAATCAAAAGAATTTGAGAAATAGTATG
AAAAGGCTTTACTGCAATCTTCTAATGATCAAGAAATGCTCAGAAAAAAAGAAGAAGAGT
TAAATTGTATTATGGAATTACAACAATAAATCAAGCAAAAACTTGAAGATTACGGAGTGC
AAAATATAGATGAGTGCTTTTAAACTCTTTAAACATAGTTGGAATAAATCAAAGAACTCA
GATAACTACTTGAATAGCAATAAATTGAAGAGGAAAACACACTAAAAGCAGATTACTTTT
CTAATCAAAGATTAATGCAAAGATCTTTAGGATAATTGTATTTCTAAACAAAAAAAAATA
AAATGGTGAAAACTGTTGTTGAAAAGAGCAATAAATACAGAAATCTAAAAATTCTAAAAT
TATATCTCAGTCATTGGAAATAATACCATGTTTTTTCAAAAATAAGAAAAACAAAATAAG
AAGACTTGCTTTAGAGAGTTTATGTTGGCTGTTTTTTTGCTTTAAAGTTTAATGTAAATA
GGAAAAAAGCATTAAAATAATTCTAAGAAAAATTCGAAAAAGGATTAGCAGTAATTTAGT
TTCGTTTAAGAGTATTTGTTTATAATCAATAATATATTTTTATATTAATAGGAAAAAGCA
TTTAGGAGTTTGTTTATATTTTTAGTTTCTAAAAAAAGAGAGAAGCAGGATGAAATTGCT
GCAGATGAGAAATACTCTTTTCTACTTTTGAAGAAAGGTTTCCAATCACTCTTTTATAAT
CATCTGCAACATTCAAATAGGAGAGATCCATTATATGAATAAAAAATGTAAATTGCAGAG
GACTCTAACATTAAATAAATTTAAATCAAAGTTCTTTCTCGTTTTCGAGATGCATGTGAA
AATTAAAAGTACAATAAAAAGAAAGTTATAGCCATGACTTAAAGAATACAATGGGCAATG
CTTAAGTATAATTTTAGAGAGTTTAAGCTTGAAGATATCAGAATGAAGAAATTAACTAGC
AGAGCAGACAAGTTTTTAGGAAGAAGAGTAAAATTAATATTTCATCAAAATTCTTTTAAT
CAAATATTTAATTAATTAGTAAAAGTATTGGCTTAGGGAAGCATTTAATGCATGGAAAGT
TGATTTTCATAATTATTTATATGAAAAATAATAAGTAAACATGCAAATCTCAAAGTTTTA
ATTGTAAAGTGTTTTTAATACATTTAAGAGAGGATATAAAATGTCTTGTCAGCAAACTGC
AAACATATAAAATTATTAGAGAAGAAAAGACTTGCTCTTATACAGCCAATATTTTGCAAT
AATTAAAAAGTTTTCTAAATAATAAATCAAAGTAAAGCAATTTGCTAAAAATTACAATAC
CAAAAAACAGCAATAATCTTTAAAATAATCGCTTTAATGCATGAAAATACATACTTAACT
GGTAAAAGAGAAAAAAATACTTGACAAAAAAGTTAAAAAAATAATATTCACAAAAGTTAT
ACAAAATTTAAGGTAAGTTTAAAATACCAAAGTCCTTTAAAAGTAAAAATTGAAAAATGT
CTTCAAGATCTAAAATTCTTAAAAGATATTCTTAATTAAATAAGCCTTAAAAAAATGGAA
CAAAGAAGCTAATAGAGACAGAAAGCTTGAAAGTGCTTTGAAATTCTATTAAAAAAATGT
AATTTTTTTTATTTATTTTGAATAGCTTTTTAACTTTATTTAAAATAATAAAAGCAATAT
TAAAAACAAGGCTACTAATTTATATCTAATTTATTACAAAATGGGAATAAACTGAAAAAG
TAGCTGAACAATCAGCTTGATGAAAAAAACATTCAACTAATGAGGGAGAATTAATACCTA
AATGAATAATTAATAGAATAACAAAAGCAAATCTATTTAATTAATGAGGAATATTAATAG
CAGGTAGTTAAATCAGAATAACTTGCAAAATATAACCTAGAGAAAGATGTTTTAATTTAG
CAATTAATCAAGTAAAATAATGATCTCAAAGAGATTAACATCCAACTGACAGAAGTTGCT
GAGAAAAGAGAAGAAAACAATTAGAATTTGGAGAGCAACTTAAACATCATCTAAGACGAA
TACGAGTAGCAGATTAGAAACTTAAAGAATGTCTAAATCTAATTCGATAAAGAAAGAGAT
CTGCTAAATAGCAATATCTAAAATTTAAATATTGAGCTCAATGCAAAAATAGAAGAAATA
AGTGAGTTTAAAAGCATAACAGCAGCAAAGAATGAAGATTTTTACTAAGAAATAACCCAA
CTAAAGAACAAAATTTTAGCTTAAGATAAAATAATTGCAGAATACGAAGAGATGACAAAA
AGCTTGTCAAATACAGTAATTAATATTTATTTATAGGAAATAATTTAGTGAAAATATTTT
ATTAAGAACAAAGAAGTAGAGAGCTTAAACATTCATCTGAATGTAAGGGTAGAGTCTTTG
CAAGAAAGAATTTCAAATTTGCAAAAAGAATCAGCTATGCAAGTTTCTTCACTTGAGAAG
TAGTTAGAATTTGCTAACAGAGAGAGATCAAACTTGATTGCACAAAACACTTCTCTGATG
AATTAAAATAAAACTTTTTAAGCAGAATTAAATCAGCTAAATCAAAACCTAAAAAAAGAG
GAGTTTAAAGTCTCTCTTCTCAGAGAGTAAGATTATGACAAAACTTCGTAATTTATACAG
TTGGCCAAAAATATTAATTCACCTAGCAGTAATTTTTATAAATCTATATTTATCAATTAA
TAAATTTTAATAAAAAAGGAAAACAAGCATCGTCTCCATTAAGATTTACTGGAAGACTAA
AAACTCTTCCTGAAGATTCTTTGATAGATGAAAGAGTTCTCAATACATCTCATTCAAGAA
TAAACACATTAATACAATAAAAAACAGACAGAAATTTATTCACTTAACCAATTACTTAGG
AAAATGGAATTTAAAATCCAAATAACAATTCTATATCATAATTTTTCTCCCATAAGGTTC
CCCAAATGAATCAAACTTAACATAATTCTATAAAAAAAGAAGTCTCTCCTTTGAGGGAAT
ATCTAACTGACATGAAATTCAGGGCCTCAGTGTTTATAAAAACAATTGACATGGATGAAA
AAAGTAAAAAAATAAATATATTTTTATAATAAATTGAAGTTAACTTGAAAAATGATTAAT
AGATAAAAAAAGCATAAGAAACTCACCATAAAAAGGCTGTATTTCCCCTTAAAAGACCTC
ATCACCACAGCTATATAAAAGCCAAAGAAATTTATAGTACAATTTCATAATTCAAATAAA
ACAAGTTTATTTAATTATATATAATATATTGAATAAAGGAATCAATCACAAACAAGTGTG
ATAAAAGATGAAATTCAAAGAAGATTGAACAATTTAGACTATAAATTTAATGAGGATATC
AAAAAATTTTAATCTTAGCAATAGCAGTGA