Identifiers and Description

Gene Model Identifier

TTHERM_00466130

Standard Name

SFR5 (Sfi1 Repeat containing protein)

Aliases

PreTt18617 | 55.m00172 | 3710.m00022

Description

hypothetical protein; predicted to have 20 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF08035 ) Opioids neuropeptide
  • ( PF08133 ) Anticodon nuclease activator family
  • ( TIGR00053 ) addiction module toxin component, YafQ
  • ( PF04605 ) Virulence-associated protein D (VapD) conserved

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00466130

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_14762.16.002516849038322e-149hypothetical protein (2441 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00466130(coding)
ATGGATGGCGAAAAAATAAACACTTCTGGAATAAGTTTAGATATCCTTGAAGACATTTTA
GAACTAGCATTCCAAAAGTGGTAGAAAGAGAAGAGATATAATCCAACTTCAGAATTTAAT
TCAATCAAAGTGTTAAGTTCTTATAATGAAATACTCTATTAGAGAAATATCAATTCAGAG
AAGGATTAGCTTTATTACAATTTCATTCATTAAATTGGCAAATAAATCCCTAAAGGCAGT
TCAAAGGATGATTGGCTTTCTTTTTGCAAATAAATTTTCAAATCGCCTGTTAAGTCTTAG
TATCAAAAATCTGAGGAGAGCGCTGAATCAAATAAGAATTTGAGCATGTATGCAAATAAA
GACTATATAAATAAATTGATGATGAAGGCCTTTATTGTTTTACTTAAAAACTGTCTCTAC
AAAAGACAAAAAAAGAAAGATCAGTTTAAAAAATAGCAATAAGAGAGCAGTTCTCCTATA
ATGAATTAAGATAATTTCATAGCAGAATCTGATAGTTTTATAAAGTACAAAAGAAATCAA
GTATCTTAGAAAAATTTATAAAAATAGTCATCTCAGTCTTAGATAAAAAATTCTCCTCAT
ATTAGTATAGATAGTCATTAAAACCAAAATAAAAGCTCTAATATGATGATGTCCCCTCCT
ACTTAGGAGTTAAGCTTATTATACAAAAGTAGCAACAATAAAATGCAAAGAGAAATTTAA
ATTGATGAGCAAAACAAATAAGTGAAACAATGCTCTGAATTAAATTTTATTCAAAAGCCT
AAAGTAAAAGAATCTCATAATGACAGTATAAGATAATTGACAGCGAAAGAATCATTAGAA
TATTAAAATTAAAGTAACAGATAGATTAAATCAAATAATAGCTTTAGCTAGTTGAATTAA
GTGACATCTCCATCTCAGCTACCTCTTTAAACAAATAACTCGCCTTCTACATATAACAAT
CTATAGATGGCATCTCCAAATAAACTTCCGAATTTTTAAAAGAAATAAAAAAATATATAT
CTGCTAGAAAACACAAAAGGATTTTAAGAGCTAGAAACTGTTGCTACAGCTTCTAATACT
GATAATTTAGCCACTATGTCATCTAATACCAACACTTTTAGAACAAAGACAATCAAATTT
ACCAAAGATAATGCTAATACTAAATATACAAAATCCCTTATAAACTGTATGTATGATAAT
CTTGATATGATTGAAACTAATATGGATGAATTAGGCGAAAATGCAATAAATATGACTAGG
ATGTCTGCTGATTTTGATGCTTCTTCAATTTGCAGAGTTAAAAATAACACAAAATTTTTA
GATGAAAGCTACTCTTTTCATCAAGTAAATACAGCTAATAATCTGTTTTAGACAGGACAC
GAGCAAAGTCTAGATGAAATGAGTTTCTAATAAACAGACTAAAGCTACAATCTGCCTTAG
AATACCACTAAAGAAAGCTTATTCGTTAAATTCATAGAAAAAAAATGTAATGAAGCCTAA
ACACCAAAAATTTTAAGTAAAAGCACAGACAGATAACTTTTTGATTTGGATTTTTGTACA
ATACAAGAAAATATTAAAATTTTGAGTTCTTATTTTATTAAACTATAAATATACAAAAAC
TAGTAAAAAAAGAAAAAGTAAATTTAGTAGTAAATTTTAAATCTAGAGAAAGAAGCTGAT
AGCTATTTTATAAGAAAGTTAAAAGATAAAGTTTTTTGCTTACTGAAAGCATTTGGGATA
GTTAGTAGTGAAACTCAGGAGAGATACAATAAAGTGAAGAGAAATAACGAGATGAAGATA
AAAAGATAATATTTGTATAAATTTGTTGAAAAATACCATGAAAAAGTTCTTGAGAAGACT
TAAATAGAATATCTTTAAAAGAATATTTCATAAAATCTCATTTAAAAAGCATTTTACTCA
ATGAAGGATTACCATGAAAAATAGTATTAAAAAAGGATGGCAGCAAATTCTTTAATTTTT
ACCTCAACAATTTCAGTAGATTTTATAATTAATCTTTATTTATCTAACATTTTAAGATAG
AATGAATCTCTTCAATTATAAAGTATTTACTAATTGTTTTAAGATTGTTCTGCTCATTAT
AATTATAAACCTTTGGTGACATCTTTAATAAAAAATGCTTTGATTACTTAAAAAAATTCC
AAACTTTTATTGAGGCAGAATGAAAATATTATTCTAAATAAAAAGCACACATACTTTTCA
GTTTTAAAATCTTTATACGAAAGAAACTTTTAAGCTTCAAATCTATATAATTACAAGGTT
ATGTAGAAAGTTTTTAATGTTTTCAAAAATTATTCTTGTAAAAGAATGCAACTTAAAGAT
GGACTTGAGCAGTTTATTTCAAAAAGATTATGCAATAAATTATAGGAAGTTATTTATTCT
TGGAAGTAATTCACTGTTGAAAACTCATTGCTACAAAGAAAAGGAAGTATTGTTTTTGAT
AAATATAGATAAAAAATGACTAAGAAATACATATCAAAGTGGATTGAAAATTTTAATAAT
TAACAAGAAGACAAATAAAAAATACTAAAATCAAATACTTTTTTTTTCTAAACTGTATGC
AGTAAAGTTCTTTTCGAAATGAAAAAGAACTCTTTAAAAAAGAAGTCAAAAAGATTAATG
AATTAAATGGCAATAAAGCATTCCAATGATAAAACCTTAAGGTTCTTTTTTGATGTTGTA
ACAGTTTTCTATGAGAGATCTAAGATAGAAAGAATAAAGTTGAGACAAATAGAAGATAAA
AAGAATCTGATAAATTTAAAATAATATTTAAATCTATGGAGACTTGAAAGATTTTACAAT
AAAATCACTTTCTAATTTAGATTAAACAATGTTTTTTAGAAGTTAATATTTGCTTTTGAA
TAGGAAAAACAAATATCAAAGGAATATGAATAAAAGGTGTAACAATTTTAGAAATAATAA
GTTTAAAGAAAAGTGCAAAAAGCCTTTGCAGTTTTATAATAAAATACTAATTTAAGCTCT
GAGTATTTCAGAGATGCTTTTTCTTTTCACTACAATACTCTTATAAGTAAAGCTTTTAAC
ATATTAAGAGTAAACAGAGAGATTAAAATGCAAAAATACTCAAATGTCTTTGAATATTTA
AATAAAAAAGCACATCAACTATAGTTCAACATCTTTGAGACTTGGAAATAAAGAGCAATT
CAAAATAGCGAGTCAAGAAAAAAAGATAAATTGGCTTTGAATTTTTACATTAAGAAACTC
TTTACTTTGATAATAAAAACTCTTTAAGACCATGCTTAATAGTAAAAATCAAAAAAGCAA
AATAAAGATTTGGCTCTTATATACTATAAAAATAGTCTTTGGAAAAGATGGAGATAAAAG
TTTATTGATAAAATAGTTATAAATCATGACAATATGAGATTGATGACATTAGGAATGAAA
TCAATGATAATCAATTTAAATAATAAGAAATAAATGAATGAAAAAATATAAAAGGCTGAT
TACTTTATGTATATGAGTCTTTTTAAGAAAGCTTAATATTTTATCGAGTTTTTGAAAATT
AATAAAGAAAAAGCTTTTTTCAAAAAGTAAGCCGTGAATAATGCTAGAGAGATAATTGAG
AAGAATTGTAAGGCAAGAATTTTCTAAGAAATGAAAAAATACTCTCAAAAAAACAAAGGC
TACACAAAAAAAATAATACTTATGAAATAAATAAAAAACTTAGAGTTGACAAAAATATAT
TTTATTAAATTGATGTAAAATTTGGCCAACAAAAAGATTTTTACAAGAAAGATTTTTGAC
AGATTAGAACTTTAGAAAAAAAAGAATTTAAAATCAGCAATCAGATTGTGGAAGAAATCA
ATTGATATTTAAAATGAAGAAATAGAGATACACGATAAGGGTGCTTTCTTACAGTAAACT
CTTCTCAAAAAAAGATTTTTTGTGAGCTTTATTTAGCATCACCAATAAATTTAAGCTGAT
AAAATATAAAATATAAAATCCATCCAGTTCTATAAAAGACAGCTCTTCTATAAATTTAGA
AATATTTTCTATAAATCTATAGAATTAAAGAAACTTAAATTTATAGCAACAAAACACTTT
GCTTTTAATTTAATGAGAAAGGGTTTCTTTGGATGGAAGTAATATTCAGTAGAGCTTTTT
GAATAAAGATATAAAAAAGTAGATGAATACTTTGATAATCCATTTTTAATGTCATAGAAA
AAGAGTACAATAAGCTTAGTTGATAAAGAAAACTTTGATATTAACTAATAAATTGCTGAG
GATTTTGATAATAATTTTGACAGTATAATGTCATATAGTAGTGATAAAAAATTAAAACCT
AACTTTGGGTAAAATTAAAATAAAGTGTTAAAGGTAATAGATAATTACAGAAAATGA


>TTHERM_00466130(protein)
MDGEKINTSGISLDILEDILELAFQKWQKEKRYNPTSEFNSIKVLSSYNEILYQRNINSE
KDQLYYNFIHQIGKQIPKGSSKDDWLSFCKQIFKSPVKSQYQKSEESAESNKNLSMYANK
DYINKLMMKAFIVLLKNCLYKRQKKKDQFKKQQQESSSPIMNQDNFIAESDSFIKYKRNQ
VSQKNLQKQSSQSQIKNSPHISIDSHQNQNKSSNMMMSPPTQELSLLYKSSNNKMQREIQ
IDEQNKQVKQCSELNFIQKPKVKESHNDSIRQLTAKESLEYQNQSNRQIKSNNSFSQLNQ
VTSPSQLPLQTNNSPSTYNNLQMASPNKLPNFQKKQKNIYLLENTKGFQELETVATASNT
DNLATMSSNTNTFRTKTIKFTKDNANTKYTKSLINCMYDNLDMIETNMDELGENAINMTR
MSADFDASSICRVKNNTKFLDESYSFHQVNTANNLFQTGHEQSLDEMSFQQTDQSYNLPQ
NTTKESLFVKFIEKKCNEAQTPKILSKSTDRQLFDLDFCTIQENIKILSSYFIKLQIYKN
QQKKKKQIQQQILNLEKEADSYFIRKLKDKVFCLLKAFGIVSSETQERYNKVKRNNEMKI
KRQYLYKFVEKYHEKVLEKTQIEYLQKNISQNLIQKAFYSMKDYHEKQYQKRMAANSLIF
TSTISVDFIINLYLSNILRQNESLQLQSIYQLFQDCSAHYNYKPLVTSLIKNALITQKNS
KLLLRQNENIILNKKHTYFSVLKSLYERNFQASNLYNYKVMQKVFNVFKNYSCKRMQLKD
GLEQFISKRLCNKLQEVIYSWKQFTVENSLLQRKGSIVFDKYRQKMTKKYISKWIENFNN
QQEDKQKILKSNTFFFQTVCSKVLFEMKKNSLKKKSKRLMNQMAIKHSNDKTLRFFFDVV
TVFYERSKIERIKLRQIEDKKNLINLKQYLNLWRLERFYNKITFQFRLNNVFQKLIFAFE
QEKQISKEYEQKVQQFQKQQVQRKVQKAFAVLQQNTNLSSEYFRDAFSFHYNTLISKAFN
ILRVNREIKMQKYSNVFEYLNKKAHQLQFNIFETWKQRAIQNSESRKKDKLALNFYIKKL
FTLIIKTLQDHAQQQKSKKQNKDLALIYYKNSLWKRWRQKFIDKIVINHDNMRLMTLGMK
SMIINLNNKKQMNEKIQKADYFMYMSLFKKAQYFIEFLKINKEKAFFKKQAVNNAREIIE
KNCKARIFQEMKKYSQKNKGYTKKIILMKQIKNLELTKIYFIKLMQNLANKKIFTRKIFD
RLELQKKKNLKSAIRLWKKSIDIQNEEIEIHDKGAFLQQTLLKKRFFVSFIQHHQQIQAD
KIQNIKSIQFYKRQLFYKFRNIFYKSIELKKLKFIATKHFAFNLMRKGFFGWKQYSVELF
EQRYKKVDEYFDNPFLMSQKKSTISLVDKENFDINQQIAEDFDNNFDSIMSYSSDKKLKP
NFGQNQNKVLKVIDNYRK


>TTHERM_00466130(gene)
ATGGATGGCGAAAAAATAAACACTTCTGGAATAAGTAAAAATATTTATTTAATTTTTTAG
CAAATATTGAGAATTTATTCATTTGTATTCAATAAAGGTTTAGATATCCTTGAAGACATT
TTAGAACTAGCATTCCAAAAGTGGTAGAAAGAGAAGAGATATAATCCAACTTCAGAATTT
AATTCAATCAAAGTGTTAAGTTCTTATAATGAAATACTCTATTAGAGAAGTAAAACTGCA
TAATTATAATATTTATTCTATTTTATTAATTTAATAAAAAAGATATCAATTCAGAGAAGG
ATTAGCTTTATTACAATTTCATTCATTAAATTGGCAAATAAATCCCTAAAGGCAGTTCAA
AGGATGATTGGCTTTCTTTTTGCAAATAAATTTTCAAATCGCCTGTTAAGTCTTAGTATC
AAAAATCTGAGGAGAGCGCTGAATCAAATAAGAATTTGAGCATGTATGCAAATAAAGACT
ATATAAATAAATTGATGATGAAGGCCTTTATTGTTTTACTTAAAAACTGTCTCTACAAAA
GACAAAAAAAGAAAGATCAGTTTAAAAAATAGCAATAAGAGAGCAGTTCTCCTATAATGA
ATTAAGATAATTTCATAGCAGAATCTGATAGTTTTATAAAGTACAAAAGAAATCAAGTAT
CTTAGAAAAATTTATAAAAATAGTCATCTCAGTCTTAGATAAAAAATTCTCCTCATATTA
GTATAGATAGTCATTAAAACCAAAATAAAAGCTCTAATATGATGATGTCCCCTCCTACTT
AGGAGTTAAGCTTATTATACAAAAGTAGCAACAATAAAATGCAAAGAGAAATTTAAATTG
ATGAGCAAAACAAATAAGTGAAACAATGCTCTGAATTAAATTTTATTCAAAAGCCTAAAG
TAAAAGAATCTCATAATGACAGTATAAGATAATTGACAGCGAAAGAATCATTAGAATATT
AAAATTAAAGTAACAGATAGATTAAATCAAATAATAGCTTTAGCTAGTTGAATTAAGTGA
CATCTCCATCTCAGCTACCTCTTTAAACAAATAACTCGCCTTCTACATATAACAATCTAT
AGATGGCATCTCCAAATAAACTTCCGAATTTTTAAAAGAAATAAAAAAATATATATCTGC
TAGAAAACACAAAAGGATTTTAAGAGCTAGAAACTGTTGCTACAGCTTCTAATACTGATA
ATTTAGCCACTATGTCATCTAATACCAACACTTTTAGAACAAAGACAATCAAATTTACCA
AAGATAATGCTAATACTAAATATACAAAATCCCTTATAAACTGTATGTATGATAATCTTG
ATATGATTGAAACTAATATGGATGAATTAGGCGAAAATGCAATAAATATGACTAGGATGT
CTGCTGATTTTGATGCTTCTTCAATTTGCAGAGTTAAAAATAACACAAAATTTTTAGATG
AAAGCTACTCTTTTCATCAAGTAAATACAGCTAATAATCTGTTTTAGACAGGACACGAGC
AAAGTCTAGATGAAATGAGTTTCTAATAAACAGACTAAAGCTACAATCTGCCTTAGAATA
CCACTAAAGAAAGCTTATTCGTTAAATTCATAGAAAAAAAATGTAATGAAGCCTAAACAC
CAAAAATTTTAAGTAAAAGCACAGACAGATAACTTTTTGATTTGGATTTTTGTACAATAC
AAGAAAATATTAAAATTTTGAGTTCTTATTTTATTAAACTATAAATATACAAAAACTAGT
AAAAAAAGAAAAAGTAAATAAATTGTTTAACATTAAAATTTTGACTAATTTTTATTTAAA
AGGTAAATTTAGTAGTAAATTTTAAATCTAGAGAAAGAAGCTGATAGCTATTTTATAAGA
AAGTTAAAAGATAAAGTTTTTTGCTTACTGAAAGCATTTGGGATAGTTAGTAGTGAAACT
CAGGAGAGATACAATAAAGTGAAGAGAAATAACGAGATGAAGATAAAAAGATAATATTTG
TATAAATTTGTTGAAAAATACCATGAAAAAGTTCTTGAGAAGACTTAAATAGAATATCTT
TAAAAGAATATTTCATAAAATCTCATTTAAAAAGCATTTTACTCAATGAAGGATTACCAT
GAAAAATAGTATTAAAAAAGGATGGCAGCAAATTCTTTAATTTTTACCTCAACAATTTCA
GTAGATTTTATAATTAATCTTTATTTATCTAACATTTTAAGATAGAATGAATCTCTTCAA
TTATAAAGTATTTACTAATTGTTTTAAGATTGTTCTGCTCATTATAATTATAAACCTTTG
GTGACATCTTTAATAAAAAATGCTTTGATTACTTAAAAAAATTCCAAACTTTTATTGAGG
CAGAATGAAAATATTATTCTAAATAAAAAGCACACATACTTTTCAGTTTTAAAATCTTTA
TACGAAAGAAACTTTTAAGCTTCAAATCTATATAATTACAAGGTTATGTAGAAAGTTTTT
AATGTTTTCAAAAATTATTCTTGTAAAAGAATGCAACTTAAAGATGGACTTGAGCAGTTT
ATTTCAAAAAGATTGTAAATATTTTTAAATTCTTCTTATTGATTGTAAATTTTATTGTAA
ATAAAAAAAGATGCAATAAATTATAGGAAGTTATTTATTCTTGGAAGTAATTCACTGTTG
AAAACTCATTGCTACAAAGAAAAGGAAGTATTGTTTTTGATAAATATAGATAAAAAATGA
CTAAGAAATACATATCAAAGTGGATTGAAAATTTTAATAATTAAGTAAATGACTTTCGTT
AATAATTATTTAAAATAATTTTTATTTTAAAATTTTTAAAAGCAAGAAGACAAATAAAAA
ATACTAAAATCAAATACTTTTTTTTTCTAAACTGTATGCAGTAAAGTTCTTTTCGAAATG
AAAAAGAACTCTTTAAAAAAGAAGTCAAAAAGATTAATGAATTAAATGGCAATAAAGCAT
TCCAATGATGTAAAAAAAAAAATGGCTTTAATTTTAATAAAATATTATACTTTTAAATTG
TAGAAAACCTTAAGGTTCTTTTTTGATGTTGTAACAGTTTTCTATGAGAGATCTAAGATA
GAAAGAATAAAGTTGAGACAAATAGAAGATAAAAAGAATCTGATAAATTTAAAATAATAT
TTAAATCTATGGAGACTTGAAAGATTTTACAATAAAATCACTTTCTAATTTAGATTAAAC
AATGTTTTTTAGAAGTTAATATTTGCTTTTGAATAGGAAAAACAAATATCAAAGGAATAT
GAATAAAAGGTGTAACAATTTTAGAAATAATAAGTTTAAAGAAAAGTGCAAAAAGCCTTT
GCAGTTTTATAATAAAATACTAATTTAAGCTCTGAGTATTTCAGAGATGCTTTTTCTTTT
CACTACAATACTCTTATAAGTAAAGCTTTTAACATATTAAGAGTAAACAGAGAGATTAAA
ATGCAAAAATACTCAAATGTCTTTGAATATTTAAGTAATTTCTTAAAAAAGGAATATTTT
AAATAAGTAAATTTTAAATAAAGATAAAAAAGCACATCAACTATAGTTCAACATCTTTGA
GACTTGGAAATAAAGAGCAATTCAAAATAGCGAGTCAAGAAAAAAAGATAAATTGGCTTT
GAATTTTTACATTAAGAAACTCTTTACTTTGATAATAAAAACTCTTTAAGACCATGCTTA
ATAGTAAAAATCAAAAAAGCAAAATAAAGTATGAACATTTTAAAAATAAAATTAATAATT
TAATTTTTTAATTAAAATTTAGGATTTGGCTCTTATATACTATAAAAATAGTCTTTGGAA
AAGATGGAGATAAAAGTTTATTGATAAAATAGTTATAAATCATGACAATATGAGATTGAT
GACATTAGGAATGAAATCAATGATAATCAATTTAAATAATAAGAAATAAATGAATGAAAA
AATATAAAAGGCTGATTACTTTATGTATATGAGTCTTTTTAAGAAAGCTTAATATTTTAT
CGAGTTTTTGAAAATTAATAAAGAAAAAGCTTTTTTCAAAAAGTAAGCCGTGAATAATGC
TAGAGAGATAATTGAGAAGGTAATTAAATAGTATTTGATTTTTTTAAAGCTAATTTGAAT
TTATTATTTTCAACAAAAGAATTGTAAGGCAAGAATTTTCTAAGAAATGAAAAAATACTC
TCAAAAAAACAAAGGCTACACAAAAAAAATAATACTTATGAAATAAATAAAAAACTTAGA
GTTGACAAAAATATATTTTATTAAATTGATGTAAAATTTGGCCAACAAAAAGATTTTTAC
AAGAAAGATTTTTGACAGATTAGAGTAAACTTATTTAGTAAATTTGATGTATTTTTATTT
AAACAAATCAATTTATAAATAGACTTTAGAAAAAAAAGAATTTAAAATCAGCAATCAGAT
TGTGGAAGAAATCAATTGATATTTAAAATGAAGAAATAGAGATACACGATAAGGGTGCTT
TCTTACAGTAAACTCTTCTCAAAAAAAGATTTTTTGTGAGCTTTATTTAGCATCACCAAT
AAATTTAAGCTGATAAAATATAAAATATAAAATCCATCCAGTTCTATAAAAGACAGCTCT
TCTATAAATTTAGAAATATTTTCTATAAATCTATAGAATTAAAGAAACTTAAATTTATAG
CAACAAAACACTTTGCTTTTAATGTAAATATTTTTTAAATTAAAAAAATTTTGACTTTCA
TTTTTAATTTAGTTAATGAGAAAGGGTTTCTTTGGATGGAAGTAATATTCAGTAGAGCTT
TTTGAATAAAGATATAAAAAAGTAGATGAATACTTTGATAATCCATTTTTAATGTCATAG
AAAAAGAGTACAATAAGCTTAGTTGATAAAGAAAACTTTGATATTAACTAATAAATTGCT
GAGGATTTTGATAATAATTTTGACAGTATAATGTCATATAGTAGTGATAAAAAATTAAAA
CCTAACTTTGGGTAAAATTAAAATAAAGTGTTAAAGGTAATAGATAATTACAGAAAATGA