Identifiers and Description

Gene Model Identifier

TTHERM_00899420

Standard Name

SFR4 (Sfi1 Repeat containing protein)

Aliases

PreTt20548 | 160.m00084

Description

oral apparatus and basal body localization; predicted to have 8 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00899420

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18630.19.997093137033517e-262hypothetical protein (1793 aa)
OxytrichaContig912.1.g990.000000100009565553302hypothetical protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00899420(coding)
ATGAATAGAAAAAATTATAATAATTATTTTGAAGAAGAGGAAGAAAGAGATTTTAGGAGA
TATCAGCTCGATGAAGATAGCGAATTTGAGTCTAGGTTAGAGGCAAAAAACATTATAAAG
GCGTTCATTTAAACAGAAAACGATGCTGAAGAAATCAAATCAAAAGCATTGAATAAAAAA
CCATCTTATTGGAAAGATTAAAAAGACAATAAAACCGATCAGCTATTTAATAGGAAATTA
GATGATGATATAGAATTGGCTTTAGATATTATAAATAAAAGGAGAGATGTTCCTAAATAA
CCAGAAAAGGATAATGTTTTATTGAATATGGAATTAAGGCATGCTAAAATTAAACAAATG
AAAGAAGATAGAATCAAATAAAAACAAGAGGCTGAGTTGAGTAGGTTGTAAGCTCAGGCT
TAAAAGTTTAGACCACCATCAGCTAATGCATAAAATAAGTCATCAAATAGAGGAAATGCA
TCGCTTTAATCTAGTACTCAAAAGAGTTAAGCTAGCAACGATTGGGAAAATTAGTCACAA
TAAAGTAGACCTTCTACAAAGCAATCACAATTAAATTATTAAAATAGCAGATAAACATTT
TAAACTCAATCAGGAGTTTCTTTGAATAACTATTTACAGAATGAAATGTCACTAACTGAT
TTGGCTTAGACTAGCCAGTAAGGAGGAAATCCAAAAAATGAAATTTAAGTGCTTAAAAAT
AAACGCTAAAATTTGGAAGTTCAATCAAAGAAAATGGAGGAAGATATGAAAAAAATGAAG
GAAAACTTAAGAAAAGAGCTGTTTTAAAATAATGATTCGTCAATGATTTCCAACAGGAAT
GGCGGGTCAAATATAAATGAAACAATCGATTACTTGCAGAAAGAAGCTGACGAAAGTAGG
ATGAAATACAATTAATTTAGGTTGCAAAAGCTAGTAAAAGCTTATAATTTTGTTCTAAAA
AGATACAAAAGACTTTTTTATAACCAAGTTTTTGAAAGTCTCAAGCAAAAAAATAGAGAA
TATATCAGACATGAGCAGCAATGTATTAACATTATGAGATTGAAGAAACTCTTTGTAGTT
TTTTCTAATTGGAAAAAGTATCTTTACTCGTAAAAGGACGAGAAGGATGTCAAGTTTTAT
TTATAAGAAAAAATTCATGAAAACACATTCTTGAATAGGGCTGGAGAATATTATAAAAGA
AGATTAATAAGAATTTGTTTGAGGCACTGGAAAAAATACTGGAAAATTTGCAAATAAGAA
TAAAAACTAAATGAAGAAAAGAATAATCTGAAATATAAAATTAAGGGTTTTATATCAAAT
TTAAAGCAGAATATATAGCAATCTGAGACTGAGGTTTAAAATTAAAAAGAATAGCATAAA
TAGAGAGTTATTGAATAATTTTTAAGGTTGAATGCATCTTAGAATTAGCAAAATATTTAA
GAAGAAGAATAGGATGAATTTGCTGAGGAATAATTATATGAAGACTCTTAATAAGAATTA
TAAAAATAAATGAATTAATAAGTTTGTGAATAAAAAAATCAAACTAACAAGGTAGGAAAA
CCTAATTAGAATGCTAAATAATAAAATATTAGGCAAGGCCCAGAACGAAATACTTTAAGG
TCAAGTATAGTTTCTTAGAATTCTGCATAAAGTGATTATAAACCAACAAGAGATAATATA
AAAAATAATGATAAAAGTCCAAATATAGTCAAAAATAGTAGAATTTAATCGAGCAGCAAG
GAAATAAAAGGGACACCATAGAAAAATTAAAGCTTACAAAATAGTAATAGGTCACCAATT
TAGAAATCTCCTTAAACTACTAATGGTAATAGATTGCCAATTAGCAAATACGATAATAGA
CACTAAAATAATAAATAGTATGAATATTAGCAATAACAATAATAGTATTAGTCTCCTTAA
AATGAGAAGGATTAGTAGTATTATGATCAAGATTATGAAGAAAATTATGATAATGATGAT
GAAGCTAAACAACAAGAATAATACTCTTATTATGATTAAAACGATTATGACTAGGAAGAT
AATCAGCAGTATTATGATGAAGAATATCATGATGATGATGATGAAAATTAACTTCAAAGC
TAAAATTATGATGGACATGAAAGTATTATGACAGATATTGCAAGGAGCAGAGTTCCTTAG
CCATCACAGTCAGATTAATAATAAATTACATTTAGATAAAATTAATAATCAAAATCACCG
AATATGAGATAAAATTCTAAGGGTCATAATGAGTCTCAAATGTCAGGATAAACTAACAAA
GAAAAAGAGAGAGAAGAAAGACTCAGATAAATTCAGCAGAGAAATGAGGATAGGAAAAAG
AAAGCTGAAGAGTTCAAAAAAAAGCATGAAGAGCTGAGAAAGTAGAAAGAAGAGGAAAAG
AAAAGGAAAGAATTAGAGGAAATCGAAAGAGAAAGAGAAAAAAGAAAAGAAGAGTTTGAA
AATTACCAAAAAAAGAAAAGAGAGGAGAAAGAGAAAAAGGAAAAAGCTGAATAGGAAAAG
AAATAACTTGCAGAAAAACTTATTTTAGCGAAAAATCATCATTAAAAATCTATTTAAAAA
TATTATGGCTTTAAGCCTTGGTCAAAGTTTATGGAATTTTAAGAGCATTTGATTGTAGTG
GCAAACTAATTCAGCTATATGAGAATTCTTAAAAATGGCTTGCAATATTTATAATAAGCC
ACTAAGCTCAGCAAATAGCTTTTTAAGTAAGAAATGGAATTTAAGGAGGAAAGAGCAAAA
AAGCATTATCAAAAAGTAGTTTTAAAGAAAGGATTTGAATTAATTCAAGGATTTAGCAAA
TAGAGTAAGGAAGAAGCTGAGGTTTATAGATAGTAAAGAATTGATTACTTAAAGAGAACT
GTTTTCTATAAATGGAATGATGTTCTTACTACTTTGAGAAATGAAAATGTTGCATTTGAA
GAATAATATAAATAAATCATTATTTAATTTAGAAAAGTGGTCCTTTAAGAAAGATCATTT
AGATCATGGAAATAATGCATAAATGAAGAAAAAATAGAAAGAATTAAAGCCTAGTAAAAA
AATGAGCTTAGAAGCAAAGCAAATTAGTGGCTAAGTGAGTTTAAATCTTCTAAAAATAGC
AACACTGAAAATTCAGATTAATAATAAGATAGTGAAGATAAGCTTTCAGAGTAGTTAAGA
AACTCTAACTTTGAAGATATAAATAAATCTCAAGTTAAAAATGAAGCTCTTAAAAAATAC
TACAATTAAAGGAACAGGATTCTGCAATAGAAAGAAGGCAGAGACAATTTGCTAGAATAA
GATTAACACTTGAAAGAAAGAGATTATGATGATGAAGAAGATAATGATGAATAATAAGGA
AATAAAGGTTACGATCATTATTAAACTAATAATGATGGATAAGATCAATACAATCAAGAA
GATGAAAATGAGCAATATTAATAAAGTAGTGAGCTATATAAATAAGAAAATGGAGAATAT
AGCGATTAGGAAGATGGATATTAAAGCATATTTAAGAATCATTAAAACATGAAAGCAATT
AATGAAAACAAAAATTATGATCTTCCTCTAGTTTAGGTTTTACAAAATACAAACGAACTC
TAAGAGAAGTTAGCTAGAAATAATTCTAAATCAAAGAATATTCAATCAAATAAATGA


>TTHERM_00899420(protein)
MNRKNYNNYFEEEEERDFRRYQLDEDSEFESRLEAKNIIKAFIQTENDAEEIKSKALNKK
PSYWKDQKDNKTDQLFNRKLDDDIELALDIINKRRDVPKQPEKDNVLLNMELRHAKIKQM
KEDRIKQKQEAELSRLQAQAQKFRPPSANAQNKSSNRGNASLQSSTQKSQASNDWENQSQ
QSRPSTKQSQLNYQNSRQTFQTQSGVSLNNYLQNEMSLTDLAQTSQQGGNPKNEIQVLKN
KRQNLEVQSKKMEEDMKKMKENLRKELFQNNDSSMISNRNGGSNINETIDYLQKEADESR
MKYNQFRLQKLVKAYNFVLKRYKRLFYNQVFESLKQKNREYIRHEQQCINIMRLKKLFVV
FSNWKKYLYSQKDEKDVKFYLQEKIHENTFLNRAGEYYKRRLIRICLRHWKKYWKICKQE
QKLNEEKNNLKYKIKGFISNLKQNIQQSETEVQNQKEQHKQRVIEQFLRLNASQNQQNIQ
EEEQDEFAEEQLYEDSQQELQKQMNQQVCEQKNQTNKVGKPNQNAKQQNIRQGPERNTLR
SSIVSQNSAQSDYKPTRDNIKNNDKSPNIVKNSRIQSSSKEIKGTPQKNQSLQNSNRSPI
QKSPQTTNGNRLPISKYDNRHQNNKQYEYQQQQQQYQSPQNEKDQQYYDQDYEENYDNDD
EAKQQEQYSYYDQNDYDQEDNQQYYDEEYHDDDDENQLQSQNYDGHESIMTDIARSRVPQ
PSQSDQQQITFRQNQQSKSPNMRQNSKGHNESQMSGQTNKEKEREERLRQIQQRNEDRKK
KAEEFKKKHEELRKQKEEEKKRKELEEIEREREKRKEEFENYQKKKREEKEKKEKAEQEK
KQLAEKLILAKNHHQKSIQKYYGFKPWSKFMEFQEHLIVVANQFSYMRILKNGLQYLQQA
TKLSKQLFKQEMEFKEERAKKHYQKVVLKKGFELIQGFSKQSKEEAEVYRQQRIDYLKRT
VFYKWNDVLTTLRNENVAFEEQYKQIIIQFRKVVLQERSFRSWKQCINEEKIERIKAQQK
NELRSKANQWLSEFKSSKNSNTENSDQQQDSEDKLSEQLRNSNFEDINKSQVKNEALKKY
YNQRNRILQQKEGRDNLLEQDQHLKERDYDDEEDNDEQQGNKGYDHYQTNNDGQDQYNQE
DENEQYQQSSELYKQENGEYSDQEDGYQSIFKNHQNMKAINENKNYDLPLVQVLQNTNEL
QEKLARNNSKSKNIQSNK


>TTHERM_00899420(gene)
ATGAATAGAAAAAATTATAATAATTATTTTGAAGAAGAGGAAGAAAGAGATTTTAGGAGA
TATCAGCTCGATGAAGATAGCGAATTTGAGTCTAGGTTAGAGGCAAAAAACATTATAAAG
GCGTTCATTTAAACAGAAAACGATGCTGAAGAAATCAAATCAAAAGCATTGAATAAAAAA
CCATCTTATTGGAAAGATTAAAAAGACAATAAAACCGATCAGCTATTTAATAGGAAATTA
GATGATGATATAGAATTGGCTTTAGAGTAAACATTAAATGTTCTTTTTTGCTTTGTAAGC
TAACATTATTTTGTAATAGTATTATAAATAAAAGGAGAGATGTTCCTAAATAACCAGAAA
AGGATAATGTTTTATTGAATATGGAATTAAGGCATGCTAAAATTAAACAAATGAAAGAAG
ATAGAATCAAATAAAAACAAGAGGGTATATTAAATTATATTTTGGACTTTATTTTTATTC
ATTTTTTTTTAATACTCAAAAGCTGAGTTGAGTAGGTTGTAAGCTCAGGCTTAAAAGTTT
AGACCACCATCAGCTAATGCATAAAATAAGTCATCAAATAGAGGAAATGCATCGCTTTAA
TCTAGTACTCAAAAGAGTTAAGCTAGCAACGATTGGGAAAATTAGTCACAATAAAGTAGA
CCTTCTACAAAGCAATCACAATTAAATTATTAAAATAGCAGATAAACATTTTAAACTCAA
TCAGGAGTTTCTTTGAATAACTATTTACAGAATGAAATGTCACTAACTGATTTGGCTTAG
ACTAGCCAGTAAGGAGGAAATCCAAAAAATGAAATTTAAGTGCTTAAAAATAAACGCTAA
AATTTGGAAGTTCAATCAAAGAAAATGGAGGAAGATATGAAAAAAATGAAGGAAAACTTA
AGAAAAGAGCTGTTTTAAAATAATGATTCGTCAATGATTTCCAACAGGAATGGCGGGTCA
AATATAAATGAAACAATCGATTACTTGCAGAAAGAAGCTGACGAAAGTAGGATGAAATAC
AATTAATTTAGGTTGCAAAAGCTAGTAAAAGCTTATAATTTTGTTCTAAAAAGATACAAA
AGACTTTTTTATAACCAAGTTTTTGAAAGTCTCAAGCAAAAAAATAGAGAATATATCAGA
CATGAGCAGCAAGTAAATAAATAAATAAATTGATTATATTAGTAAGTTTAGGTAATAAAT
CTTATATTTTAAAAGTGTATTAACATTATGAGATTGAAGAAACTCTTTGTAGTTTTTTCT
AATTGGAAAAAGTATCTTTACTCGTAAAAGGACGAGAAGGATGTCAAGTTTTATTTATAA
GAAAAAATTCATGAAAACACATTCTTGGTAATAAATTTTTTGCAAAATAAATCTATCAGC
GATATTTGCTTAATTATAATTTAATATTTTATCTAGAATAGGGCTGGAGAATATTATAAA
AGAAGATTAATAAGAATTTGTTTGAGGCACTGGAAAAAATACTGGAAAATTTGCAAATAA
GAATAAAAACTAAATGAAGAAAAGAATAATCTGAAATATAAAATTAAGGGTTTTATATCA
AATTTAAAGCAGAATATATAGCAATCTGAGACTGAGGTTTAAAATTAAAAAGAATAGCAT
AAATAGAGAGTTATTGAATAATTTTTAAGGTTGAATGCATCTTAGAATTAGCAAAATATT
TAAGAAGAAGAATAGGATGAATTTGCTGAGGAATAATTATATGAAGACTCTTAATAAGAA
TTATAAAAATAAATGAATTAATAAGTTTGTGAATAAAAAAATCAAACTAACAAGGTAGGA
AAACCTAATTAGAATGCTAAATAATAAAATATTAGGCAAGGCCCAGAACGAAATACTTTA
AGGTCAAGTATAGTTTCTTAGAATTCTGCATAAAGTGATTATAAACCAACAAGAGATAAT
ATAAAAAATAATGATAAAAGTCCAAATATAGTCAAAAATAGTAGAATTTAATCGAGCAGC
AAGGAAATAAAAGGGACACCATAGAAAAATTAAAGCTTACAAAATAGTAATAGGTCACCA
ATTTAGAAATCTCCTTAAACTACTAATGGTAATAGATTGCCAATTAGCAAATACGATAAT
AGACACTAAAATAATAAATAGTATGAATATTAGCAATAACAATAATAGTATTAGTCTCCT
TAAAATGAGAAGGATTAGTAGTATTATGATCAAGATTATGAAGAAAATTATGATAATGAT
GATGAAGCTAAACAACAAGAATAATACTCTTATTATGATTAAAACGATTATGACTAGGAA
GATAATCAGCAGTATTATGATGAAGAATATCATGATGATGATGATGAAAATTAACTTCAA
AGCTAAAATTATGATGGACATGAAAGTATTATGACAGATATTGCAAGGAGCAGAGTTCCT
TAGCCATCACAGTCAGATTAATAATAAATTACATTTAGATAAAATTAATAATCAAAATCA
CCGAATATGAGATAAAATTCTAAGGGTCATAATGAGTCTCAAATGTCAGGATAAACTAAC
AAAGAAAAAGAGAGAGAAGAAAGACTCAGATAAATTCAGCAGAGAAATGAGGATAGGAAA
AAGAAAGCTGAAGAGTTCAAAAAAAAGTATTTAAAAATTTCATAATAAATTAAATTTAAA
TGTTTATTGGAAACTCTAGGCATGAAGAGCTGAGAAAGTAGAAAGAAGAGGAAAAGAAAA
GGAAAGAATTAGAGGAAATCGAAAGAGAAAGAGAAAAAAGAAAAGAAGAGTTTGAAAATT
ACCAAAAAAAGAAAAGAGAGGAGAAAGAGAAAAAGGAAAAAGCTGAATAGGAAAAGAAAT
AACTTGCAGAAAAACTTATTTTAGCGAAAAATCATCATTAAAAATCTATTTAAGTAATTT
TTAAGTTTTTTTATCATTTTATTTATTTAATTTGTTATTTTATTTTTTTAGAAATATTAT
GGCTTTAAGCCTTGGTCAAAGTTTATGGAATTTTAAGAGCATTTGATTGTAGTGGCAAAC
TAATTCAGCTATATGAGAATTCTTAAAAATGGCTTGCAATATTTATAATAAGCCACTAAG
CTCAGCAAATAGCTTTTTAAGTAAGAAATGGAATTTAAGGAGGAAAGAGCAAAAAAGCAT
TATCAAAAAGTAGTTTTAAAGTAAATTCATTGTGTAGTTGTTCTCACGATTAATATTAAT
TATAATGTGAATTTAAAGGAAAGGATTTGAATTAATTCAAGGATTTAGCAAATAGAGTAA
GGAAGAAGCTGAGGTTTATAGATAGTAAAGAATTGATTACTTAAAGAGAACTGTTTTCTA
TAAATGGAATGATGTTCTTACTACTTTGAGAAATGAAAATGTTGCATTTGAAGAATAATA
TAAATAAATCATTATTTAATTTAGAAAAGTAAATCTTTTAAATATTTAAGAAATCCTTAT
TAAAAAATAAAATTTATCTAGGTGGTCCTTTAAGAAAGATCATTTAGATCATGGAAATAA
TGCATAAATGAAGAAAAAATAGAAAGAATTAAAGCCTAGTAAAAAAATGAGCTTAGAAGC
AAAGCAAATTAGTGGCTAAGTGAGTTTAAATCTTCTAAAAATAGCAACACTGAAAATTCA
GATTAATAATAAGATAGTGAAGATAAGCTTTCAGAGTAGTTAAGAAACTCTAACTTTGAA
GATATAAATAAATCTCAAGTTAAAAATGAAGCTCTTAAAAAATACTACAATTAAAGGAAC
AGGATTCTGCAATAGAAAGAAGGCAGAGACAATTTGCTAGAATAAGATTAACACTTGAAA
GAAAGAGATTATGATGATGAAGAAGATAATGATGAATAATAAGGAAATAAAGGTTACGAT
CATTATTAAACTAATAATGATGGATAAGATCAATACAATCAAGAAGATGAAAATGAGCAA
TATTAATAAAGTAGTGAGCTATATAAATAAGAAAATGGAGAATATAGCGATTAGGAAGAT
GGATATTAAAGCATATTTAAGAATCATTAAAACATGAAAGCAATTAATGAAAACAAAAAT
TATGATCTTCCTCTAGTTTAGGTTTTACAAAATACAAACGAACTCTAAGAGAAGTTAGCT
AGAAATAATTCTAAATCAAAGAATATTCAATCAAATAAATGA