Identifiers and Description

Gene Model Identifier

TTHERM_00522410

Standard Name

SFR3 (Sfi1 repeat containing protein)

Aliases

PreTt12356 | 65.m00174 | 3717.m00053

Description

basal body localization; predicted to have 26 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00249 ) Myb-like DNA-binding domain
  • ( PF02671 ) Paired amphipathic helix repeat
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.9%

TetraMine Data

TTHERM_00522410

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12865.17.996885557285438e-77hypothetical protein (385 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00522410(coding)
ATGAGCGGATCTCAAGAAGAATAATTAAAAGCTTTTTATGATCAGCTCGATAGATTTAAT
AGTTTTTGGATTAAGAAGAGGATCTTTTCAAGATGGAAAGAGCATTTTGTTGATACAAAA
CAACGTATATAAAAAATAATAAAATCAATGGATTTAAATGAGTAATGGATTTTAAGGTAT
CACTTATAAAGCTGGAAGAAATTTGTTTTAATTTAGCACTAAAAAAGAGCCACAAAATTA
AGAAAAATTTAATTAGCTAAGAGAGTAATCAACCGTTGGAGAAACTACATTGCAAGGAAT
AAGTACTTGACACTTTTTAAATATTTTAACTTGATGAGAAAAGATTATGTAGAAAATAAA
ATAAAGAAAGTTATTATGGAAAAGAAAAATTATAAGATATTAAAGGGATACTTCTAGCTC
ATGAAAGACTATAGTATTCATAGCTTTTAAAAAGAAATTAACATGCATGAAAAATGCTTA
CTTTTGTATAAAAGGAATCTTAAAAAAAAATATTTTAATTCTCTGAAGCTTAGTGCCAAG
ATTAAAAGAGATGTAGAATACATGAGATCTACTGCTTTAGAGTCAAGGAGATTTTACATC
TTTAAGGCATTTTTTTAGCCATGGAAAGAAATCACTCAAAAAAGGAAAATTAATAGATGC
TGTTTTTTAATTTTATAGCAGCAACAAAATTTAAAACGTAAATAGTAGATATTCTATACA
TGGATACACTCATCAATTAAAAACTACCAAGTTAGAGTATTTTCTGAAAAGAACTTGATG
TTTAAATATTTCAAGATATTACAATCATGGTATCTTAAGCAATCAAAAAAGAAATATTAA
TTGCAATACTTTACAAATAAAAAAGTAAATGGTTTAAAAAAACTAATTTTGTTAGAGTGG
TTTTAATATGCGAATAGGAAAGTTACAAGAGAGAAAAAATGTGAAGCATATTTGTTAAAA
AAATAAATCATGCTTTTAGAAAAGAGTTTTCAGGCATTTAAGTCAGTTTGTGATAAATAA
ATAAGAAAGGAAAAGCTTATCTACCTTTCGATGAAACACTATTAGATTACTACTCTTAAA
AAATATTTTGAAAGCTGGGCACTATATTTAGATTAAAATCAGAGATAGTATCTAAATAAG
CTCGAAGCTTATAGGCATAGTGAAAAAATGCTGTAAAGACTTTACTTCAAAACTTTCAAA
ATTCTATTGCAAAAAAAAAAGTTTTTAAGAGATGTAGAAGCTTAAATTGAGTTAAGAAAA
ATATAAAGAGATAGATAGTCAATTTTCTAATTTATGAAGTCCTAAATGTAGCAAAACTAT
TTAATTCAAAAAAAGGTATTAGAAAGATATTAATACAAAAAGCTAAGTTCTACGTTTTAA
GAGTTAATTAGCTATTCAAAAAAATAAAAACAAAAAAAGATAATCATAAAATAAAATATA
ATGAAACTGAATTTTAGGCTAATTCAAAAAACTTTCAGTTCTTGGGCTTTTAGATCAAAT
TAAAATAAATTACCTAGGTATTAAAAATTAAATGCTTAATTATTCAAACAAACTAAATAA
TATTCTAAATTCTTTTAGCTTTTAAAGAAAAAATGGATAAGAAGTAAAATTGGAAAGTTT
ATTTAGCAAAAAAAATAAAGTAAATTATAAGAAAGTGCCTTTCATCTTTGGAGATATCTT
AAAATTTAGGAAGAAAGAATAAACAGTAATTTGATACAATCAATCATTAATAAGTCTTAT
AAAATGTTTTTCATTCTAAAAGAGTATGCTATTAAAAAAAAGAAATAAAGAGAAATTATA
AATTTTACTAAGTAAAAGAGAAATTATAGGATTTAAAAACTAGGATGGAGTGTTTGGAAA
TTCTTTTTAAGATTGAAAGATGAAAAGAATATGTATAAGATGAGTCTTCTCAGATATGCT
TTATCGAAGAAGGCAAAAAAAATGTTAGAGGCTTGGGGAAGCCATGTTTCTAAAAGAAAG
AATTTAAATGAATTATCATTAAAAGTGTAGTTAAACTAGTAAAAATGGAGGAAAATGATG
CTATTACGCATATTAAAAGAAGGAGCCAAAGGACAACTGGATTTTATTAATTTCATAAAG
CAGTATAGGATGAAAAATAATCTAAAAACTCAAAGAAAAGCATTTTAAATCTTAACTTAA
TATGCTGAGAAAAAAAATATAATAAAGAGGATAATTCAATCTAATAGAGAAGCTATTTAA
TATAGATAATTGCAAAATATTTTGGTAGAATGGTAATACTACATATAAAGAAAAAAGAGA
GATCAACTAAAATTAGAGGAACACATTTCATTTAAGTAATGTGTATAAATATCGAAAGTT
ATTAAATACTGGAGGAGATTAACTAAGGTTTTAGCCAAAGAAAATAATAAAATAGCTATT
ATATAAAATAATACTAAAAAGAAGATGGAATTCAGTTACTTTTATTAGTGGTGCGAAGTA
TATCAAGAAAAAAGATTTAGAGAATAGACTGATAAAATGCAGTAGTTTTTAGAAAAAAGA
GTAGCTTTTAATTTAGTTATGAGAGCTTTAAGAAGATAGGTAGATTAAAAGAATTAGAAA
ATAAATACAGATGCTTTTGCTATAAATCACTATATATAAAATACTTATAAAAAGATTTTT
GAATCTTTGTAGTATTTTAAGTAAGAATCTAAAAGGAAGAAAGGATTAGAAATCATGTCT
AATCTTTTGGCAAAAGCTATTTCATTTAAAAGAGTTGTCAAAAAATTTAAAGTAGCTAAA
AATTATTCTTACCACAGAAAGCATTGCTTTAAATACTACATAACTAAACTTTACCATAAA
TGCTTTTATATATTAAAATAATATTAATCATTCAGAGAAAACTAGAGGAAATTGGCCCTA
AAATAATTTTAATCTCTTTAACTTTAAAAGTTATAAAAGTGCTTTTAGTATTTAAAAAGA
AACGTTGATATTTAGATGAACCAGAGAATTTTCAAAAAGAAATTTGAGAAGAAAAAAACT
CTAAGATTAAAAAAGCTATCTATGCTCATTTGGAAAGATTATTACATCAGAAAGAGATTT
ATAAATACTAAGATAAGAGAATTTAGAGAGAATACAAATTAAAAAATGCTTAGATAAGCA
TTTATAGAGCTTCATAGCTATCGTTTGAATAAAACATATATGAAAAAGTGTAAACAAACA
GCTGAACTTTTTAATATTAACAGAATTAAAAAAGGATATTTTAATTCATGGAAAATTACT
TGTGATGAAGAAAAGTATAAAATAAGACAAAGCAACTTAGCATTTAGACATTATTCTTTT
AATGTTCTTGTAAAGTCACTTCGCTAATGGATAAGATATATTCAAAGAGAAAAAATAGAA
AACAATTAAACTTACAATGGAGTTGCTCTTCGCTCAATTAAATTAAAATAATATGCATTT
TAATAACTTAAAAAGAATTATACGTTATAAACTAAAAGTAAAATAGCAAAAGCAAATCAC
AATGTTTTAACAAAGGCTGTTTTTCTTAGAAAGTGGAAAAGAGTTACTATTAAAAATAAA
TTAAGTAAACCAGCCATATAGACAATAAACAACCATTTAAGCATTGCTATTAAAAGGGTA
TGCTTTGATAAAATTAGATAAAGAAGCTAAAAAGGAGATATCTTATAAAAAATAGCTAGA
ATTTATAATCATAATCTCAACTATAATGTCTTGAAGGCATTTTTAGTAAATATGCTTCTG
CAAAGAAGAATAGAAATATATTAATTGCGTAGAAATTTCCAGACAACAAAAATAGTTTTT
AGCATACTGAAGTAATATGCTGAAATTAAAAAGAAAAGAGTGTAAAAAGTAGTTCATACA
CTACAAAATATTCATGGAATGATTTAATACAACTTAGCTTAAAAAGTATTTTATGCTTTA
AAGTAATACCATTACATGAAAGTTCTTAAGCGCAATACTCTAATCCGTTATATGAATTAG
CTAAAACTAAAAACTTTTCTTTCATTTCGCAAATATGTACTAGAAGTTCATGAATAAGGT
CCAAATGAAAGTAGAATAGCTGCCGTCCATATTTGA


>TTHERM_00522410(protein)
MSGSQEEQLKAFYDQLDRFNSFWIKKRIFSRWKEHFVDTKQRIQKIIKSMDLNEQWILRY
HLQSWKKFVLIQHQKRATKLRKIQLAKRVINRWRNYIARNKYLTLFKYFNLMRKDYVENK
IKKVIMEKKNYKILKGYFQLMKDYSIHSFQKEINMHEKCLLLYKRNLKKKYFNSLKLSAK
IKRDVEYMRSTALESRRFYIFKAFFQPWKEITQKRKINRCCFLILQQQQNLKRKQQIFYT
WIHSSIKNYQVRVFSEKNLMFKYFKILQSWYLKQSKKKYQLQYFTNKKVNGLKKLILLEW
FQYANRKVTREKKCEAYLLKKQIMLLEKSFQAFKSVCDKQIRKEKLIYLSMKHYQITTLK
KYFESWALYLDQNQRQYLNKLEAYRHSEKMLQRLYFKTFKILLQKKKFLRDVEAQIELRK
IQRDRQSIFQFMKSQMQQNYLIQKKVLERYQYKKLSSTFQELISYSKKQKQKKIIIKQNI
MKLNFRLIQKTFSSWAFRSNQNKLPRYQKLNAQLFKQTKQYSKFFQLLKKKWIRSKIGKF
IQQKKQSKLQESAFHLWRYLKIQEERINSNLIQSIINKSYKMFFILKEYAIKKKKQREII
NFTKQKRNYRIQKLGWSVWKFFLRLKDEKNMYKMSLLRYALSKKAKKMLEAWGSHVSKRK
NLNELSLKVQLNQQKWRKMMLLRILKEGAKGQLDFINFIKQYRMKNNLKTQRKAFQILTQ
YAEKKNIIKRIIQSNREAIQYRQLQNILVEWQYYIQRKKRDQLKLEEHISFKQCVQISKV
IKYWRRLTKVLAKENNKIAIIQNNTKKKMEFSYFYQWCEVYQEKRFREQTDKMQQFLEKR
VAFNLVMRALRRQVDQKNQKINTDAFAINHYIQNTYKKIFESLQYFKQESKRKKGLEIMS
NLLAKAISFKRVVKKFKVAKNYSYHRKHCFKYYITKLYHKCFYILKQYQSFRENQRKLAL
KQFQSLQLQKLQKCFQYLKRNVDIQMNQRIFKKKFEKKKTLRLKKLSMLIWKDYYIRKRF
INTKIREFRENTNQKMLRQAFIELHSYRLNKTYMKKCKQTAELFNINRIKKGYFNSWKIT
CDEEKYKIRQSNLAFRHYSFNVLVKSLRQWIRYIQREKIENNQTYNGVALRSIKLKQYAF
QQLKKNYTLQTKSKIAKANHNVLTKAVFLRKWKRVTIKNKLSKPAIQTINNHLSIAIKRV
CFDKIRQRSQKGDILQKIARIYNHNLNYNVLKAFLVNMLLQRRIEIYQLRRNFQTTKIVF
SILKQYAEIKKKRVQKVVHTLQNIHGMIQYNLAQKVFYALKQYHYMKVLKRNTLIRYMNQ
LKLKTFLSFRKYVLEVHEQGPNESRIAAVHI


>TTHERM_00522410(gene)
ATGAGCGGATCTCAAGAAGAATAATTAAAAGCTTTTTATGATCAGCTCGATAGATTTAAT
AGTTTTTGGATTAAGAAGAGGATCTTTTCAAGATGGAAAGAGCATTTTGTTGATACAAAA
CAACGTATATAAAAAATAATAAAATCAATGGATTTAAATGAGTAATGGATTTTAAGGTAT
CACTTATAAAGCTGGAAGAAATTTGTTTTAATTTAGCACTAAAAAAGAGCCACAAAATTA
AGAAAAATTTAATTAGCTAAGAGAGTAATCAACCGTTGGAGAAACTACATTGCAAGGAAT
AAGTACTTGACACTTTTTAAATATTTTAACTTGATGAGAAAAGATTATGTAGAAAATAAA
ATAAAGAAAGTTATTATGGAAAAGAAAAATTATAAGATATTAAAGGGATACTTCTAGCTC
ATGAAAGACTATAGTATTCATAGCTTTTAAAAAGAAATTAACATGCATGAAAAATGCTTA
CTTTTGTATAAAAGGAATCTTAAAAAAAAATATTTTAATTCTCTGAAGCTTAGTGCCAAG
ATTAAAAGAGATGTAGAATACATGAGATCTACTGCTTTAGAGTCAAGGAGATTTTACATC
TTTAAGGCATTTTTTTAGCCATGGAAAGAAATCACTCAAAAAAGGAAAATTAATAGATGC
TGTTTTTTAATTTTATAGCAGCAACAAAATTTAAAACGTAAATAGTAGATATTCTATACA
TGGATACACTCATCAATTAAAAACTACCAAGTTAGAGTATTTTCTGAAAAGAACTTGATG
TTTAAATATTTCAAGATATTACAATCATGGTAAATTAGATTTTTTATTAATATTTTTTAT
ATTTTTTTAATTATAAAAAGGTATCTTAAGCAATCAAAAAAGAAATATTAATTGCAATAC
TTTACAAATAAAAAAGTAAATGGTTTAAAAAAACTAATTTTGTTAGAGTGGTTTTAATAT
GCGAATAGGAAAGTTACAAGAGAGAAAAAATGTGAAGCATATTTGTTAAAAAAATAAATC
ATGCTTTTAGAAAAGAGTTTTCAGGCATTTAAGTCAGTTTGTGATAAATAAATAAGAAAG
GAAAAGCTTATCTACCTTTCGATGAAACACTATTAGATTACTACTCTTAAAAAATATTTT
GAAAGCTGGGCACTATATTTAGATTAAAATCAGAGATAGTATCTAAATAAGCTCGAAGCT
TATAGGCATAGTGAAAAAATGCTGTAAAGACTTTACTTCAAAACTTTCAAAATTCTATTG
CAAAAAAAAAAGTAAATTATTTTTTTATTTTTATTTTAAAGAGCTGGGTTAAAAACTTTA
ATAATGATTTTAAATAAAACAATTTAATATTATTTAGAAATTATCAATTAATATAAATTG
AATGAATATCCCTCCTCTTTTTTAATTAACAATTGTTACTTGAAAGATATTTTATTTAGT
TTTTAAAATAAATTTTTAGGTTTTTAAGAGATGTAGAAGCTTAAATTGAGTTAAGAAAAA
TATAAAGAGATAGATAGTCAATTTTCTAATTTATGAAGTCCTAAATGTAGCAAAACTATT
TAATTCAAAAAAAGGTATTAGAAAGATATTAATACAAAAAGCTAAGTTCTACGTTTTAAG
AGTTAATTAGCTATTCAAAAAAATAAAAACAAAAAAAGATAATCATAAAATAAAATATAA
TGAAACTGAATTTTAGGCTAATTCAAAAAACTTTCAGTTCTTGGGCTTTTAGATCAAATT
AAAATAAATTACCTAGGTATTAAAAATTAAATGCTTAATTATTCAAACAAACTAAATAAT
ATTCTAAATTCTTTTAGCTTTTAAAGAAAAAATGGATAAGAAGTAAAATTGGAAAGTTTA
TTTAGCAAAAAAAATAAAGTAAATTATAAGAAAGTGCCTTTCATCTTTGGAGATATCTTA
AAATTTAGGAAGAAAGAATAAACAGTAATTTGATACAATCAATCATTAATAAGTCTTATA
AAATGTTTTTCATTCTAAAAGAGTATGCTATTAAAAAAAAGAAATAAAGAGAAATTATAA
ATTTTACTAAGTAAAAGAGAAATTATAGGATTTAAAAACTAGGATGGAGTGTTTGGAAAT
TCTTTTTAAGATTGAAAGATGAAAAGAATATGTATAAGATGAGTCTTCTCAGATATGCTT
TATCGAAGAAGGCAAAAAAAATGTTAGAGGCTTGGGGAAGCCATGTTTCTAAAAGAAAGA
ATTTAAATGAATTATCATTAAAAGTGTAGTTAAACTAGTAAAAATGGAGGAAAATGATGC
TATTACGCATATTAAAAGAAGGAGCCAAAGGACAACTGGATTTTATTAATTTCATAAAGC
AGTATAGGATGAAAAATAATCTAAAAACTCAAAGAAAAGCATTTTAAATCTTAACTTAAT
ATGCTGAGAAAAAAAATATAATAAAGAGGATAATTCAATCTAATAGAGAAGCTATTTAAT
ATAGATAATTGCAAAATATTTTGGTAGAATGGTAATACTACATATAAAGAAAAAAGAGAG
ATCAACTAAAATTAGAGGAACACATTTCATTTAAGTAATGTGTATAAATATCGAAAGTTA
TTAAATACTGGAGGAGATTAACTAAGGTTTTAGCCAAAGAAAATAATAAAATAGCTATTA
TATAAAATAATACTAAAAAGAAGATGGAATTCAGTTACTTTTATTAGTGGTGCGAAGTAT
ATCAAGAAAAAAGATTTAGAGAATAGACTGATAAAATGCAGTAGTTTTTAGAAAAAAGAG
TAGCTTTTAATTTAGTTATGAGAGCTTTAAGAAGATAGGTAGATTAAAAGAATTAGAAAA
TAAATACAGATGCTTTTGCTATAAATCACTATATATAAAATACTTATAAAAAGATTTTTG
AATCTTTGTAGTATTTTAAGTAAGAATCTAAAAGGAAGAAAGGATTAGAAATCATGTCTA
ATCTTTTGGCAAAAGCTATTTCATTTAAAAGAGTTGTCAAAAAATTTAAAGTAGCTAAAA
ATTATTCTTACCACAGAAAGCATTGCTTTAAATACTACATAACTAAACTTTACCATAAAT
GCTTTTATATATTAAAATAATATTAATCATTCAGAGAAAACTAGAGGAAATTGGCCCTAA
AATAATTTTAATCTCTTTAACTTTAAAAGTTATAAAAGTGCTTTTAGTATTTAAAAAGAA
ACGTTGATATTTAGATGAACCAGAGAATTTTCAAAAAGAAATTTGAGAAGAAAAAAACTC
TAAGATTAAAAAAGCTATCTATGCTCATTTGGAAAGATTATTACATCAGAAAGAGATTTA
TAAATACTAAGATAAGAGAATTTAGAGAGAATACAAATTAAAAAATGCTTAGATAAGCAT
TTATAGAGCTTCATAGCTATCGTTTGAATAAAACATATATGAAAAAGTGTAAACAAACAG
CTGAACTTTTTAATATTAACAGAATTAAAAAAGGATATTTTAATTCATGGAAAATTACTT
GTGATGAAGAAAAGTATAAAATAAGACAAAGCAACTTAGCATTTAGACATTATTCTTTTA
ATGTTCTTGTAAAGTCACTTCGCTAATGGATAAGATATATTCAAAGAGAAAAAATAGAAA
ACAATTAAACTTACAATGGAGTTGCTCTTCGCTCAATTAAATTAAAATAATATGCATTTT
AATAACTTAAAAAGAATTATACGTTATAAACTAAAAGTAAAATAGCAAAAGCAAATCACA
ATGTTTTAACAAAGGCTGTTTTTCTTAGAAAGTGGAAAAGAGTTACTATTAAAAATAAAT
TAAGTAAACCAGCCATATAGACAATAAACAACCATTTAAGCATTGCTATTAAAAGGGTAT
GCTTTGATAAAATTAGATAAAGAAGCTAAAAAGGAGATATCTTATAAAAAATAGCTAGAA
TTTATAATCATAATCTCAACTATAATGTCTTGAAGGCATTTTTAGTAAATATGCTTCTGC
AAAGAAGAATAGAAATATATTAATTGCGTAGAAATTTCCAGACAACAAAAATAGTTTTTA
GCATACTGAAGTAATATGCTGAAATTAAAAAGAAAAGAGTGTAAAAAGTAGTTCATACAC
TACAAAATATTCATGGAATGATTTAATACAACTTAGCTTAAAAAGTATTTTATGCTTTAA
AGTAATACCATTACATGAAAGTTCTTAAGCGCAATACTCTAATCCGTTATATGAATTAGC
TAAAACTAAAAACTTTTCTTTCATTTCGCAAATATGTACTAGAAGTTCATGAATAAGGTC
CAAATGAAAGTAGAATAGCTGCCGTCCATATTTGA