Identifiers and Description

Gene Model Identifier

TTHERM_00925730

Standard Name

SFR2 (Sfi1 Repeat containing protein)

Aliases

PreTt04380 | 165.m00098 | 3747.m00348

Description

hypothetical protein; predicted to have 4 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.4%

TetraMine Data

TTHERM_00925730

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20675.19.997093137033517e-262hypothetical protein (533 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00925730(coding)
ATGAATAACTAAGAGACATTAGCAGATTGCTTTGCTGTATTGCAATTATATGCTGAAAGA
AGGATTAAAAAAAGAAACCAATTAATGCTCTCTAGTTTGTTTAGATATAAATAAATGTTT
CAAAAATTTTATAAGGCCACTCAGTTAAGTTAAAAAATAGACTATGTTCTGCCATATTTT
AGGAGATTTTTGAGAAATATTCATGAAAAAAGGATGAAAATAGTCAAATTTATAATTAAT
AAAGAGAAAGTAGGTTTATAAAAATAGTATTAATCATGGAAGACTTATTTCCTGAAGAAG
AAAAACTAGAGAGAACTATTATAAACTATTTAAGAATATAAAGAAGCCTAAATTATTGAA
AAAGCCTTTAATAACTTAAGAAAAAATATAATATTTAGCTAAGGTTTGAAGAGATTAATA
AAGAACCAAATATACAGAAGATAAGCAGTAGGATTTGCAAGTTTAAAAGAATATCTTAAA
ATTCAAAAATTCAAAAGAGATACTTTAAAGAGTGTCAGAGATTACTTTTAGTAAAATACT
CTTTTAAAGTGCTTTAAATATTGGAATTATGGATGCTCTAAAGCAGATGAAGACATTCAT
AAATATCTCCGTTTAAGAAATTGTTTCTTAAATTGGAGAAATGGTTTAGATAGGAATAAT
GATTTAAACATGAAAAAAATAACTCTTTTTAGAGTTCATTCTCTCTTAAAGTGGAATTTT
ATCAGACTTAAAAAAATAGTTGAATTTGAAAAGCTCAATTCTATGGCAAAAAAGTTTCAT
CTTTTCTAAATTTTTCATGCTTTCTGCATAGTGGTTAGGAAAAATAAGTTTAAATAATAT
AAAAAGAGAAAGGCTCTCCATTACTTTAAAAATTAGCACTCATTTTTTCTAAAGAAGAGG
ATATTCTAGCTTTTCAAGAAAGCCGTCTCAATAAGCCAAGAAGAAAGGTTTAAAGATGAG
GCAGTGAATTCTTATTATGAGAGTAAAGAGAAGGAGAGATTGGCTTTGTAAACATTTTAA
AGGTTAAAATTGAATGTTAAGATTAATAAAGCAGAAAGACACAGAAAAAATAAACTGCAA
AAGAAGTCACTTTAGAGGTGGAGGGAGTTTAGATAAGTTTCTATTGAGAGAAAAAGATTA
ATTGTCTTGAAAATTTTTAACAGAAAAAAAGATCTGATTGAAAAATCTTTCTTTTTCTTA
AAAAAGTTTGTAGAATACAGAAGGGCTAAACTAAAAATGGCTGTTTAATATTATCAAAAG
AGGATGATGAGAACTTCTTTATATAATTGGCTTGGAAATATTGTTAATGACTATCTGCTT
AAACAAGTAGATGCAGACAATTACTACAAATTTAAAATTAAGTTAAGATGTTTCCAACAA
TTAGAAAAGAATAAAAATATTTAACAAAGAAAAAAATTAATTGAAACAAGAATAATTAAC
TTTTAAAATAAACAAGAAGATATCTTGTTATGGAGAAGCTTTTAGAAATTTAAAGGTATG
ATAGTGTCCATTTTACGGCATAAAAAATACAACTATGATTTAGTTAATTCTGTATTTTAT
AATTGGAAATTATTGATAAAGATGAAAAAGATATACTGA


>TTHERM_00925730(protein)
MNNQETLADCFAVLQLYAERRIKKRNQLMLSSLFRYKQMFQKFYKATQLSQKIDYVLPYF
RRFLRNIHEKRMKIVKFIINKEKVGLQKQYQSWKTYFLKKKNQRELLQTIQEYKEAQIIE
KAFNNLRKNIIFSQGLKRLIKNQIYRRQAVGFASLKEYLKIQKFKRDTLKSVRDYFQQNT
LLKCFKYWNYGCSKADEDIHKYLRLRNCFLNWRNGLDRNNDLNMKKITLFRVHSLLKWNF
IRLKKIVEFEKLNSMAKKFHLFQIFHAFCIVVRKNKFKQYKKRKALHYFKNQHSFFLKKR
IFQLFKKAVSISQEERFKDEAVNSYYESKEKERLALQTFQRLKLNVKINKAERHRKNKLQ
KKSLQRWREFRQVSIERKRLIVLKIFNRKKDLIEKSFFFLKKFVEYRRAKLKMAVQYYQK
RMMRTSLYNWLGNIVNDYLLKQVDADNYYKFKIKLRCFQQLEKNKNIQQRKKLIETRIIN
FQNKQEDILLWRSFQKFKGMIVSILRHKKYNYDLVNSVFYNWKLLIKMKKIY


>TTHERM_00925730(gene)
ATGAATAACTAAGAGACATTAGCAGATTGCTTTGCTGTATTGCAATTATATGCTGAAAGA
AGGTAAAACTTTTAAAATGCTTAAATTCAATTGTAATAATTTTGAATTATCAAATAGGAT
TAAAAAAAGAAACCAATTAATGCTCTCTAGTTTGTTTAGATATAAATAAATGTTTCAAAA
ATTTTATAAGGCCACTCAGTTAAGTTAAAAAATAGACTATGTTCTGCCATATTTTAGGAG
ATTTTTGAGAAATATTCATGAAAAAAGGATGAAAATAGTCAAATTTATAATTAATAAAGA
GAAAGTAGGTTTATAAAAGTAAGTAAATAAATGATTTAATTTTTAGAATTTTTGCAATAA
ATAGTATTTTTTAAGATAGTATTAATCATGGAAGACTTATTTCCTGAAGAAGAAAAACTA
GAGAGAACTATTATAAACTATTTAAGAATATAAAGAAGCCTAAATTATTGAAAAAGCCTT
TAATAACTTAAGAAAAAATATAATATTTAGCTAAGGTTTGAAGAGATTAATAAAGAACCA
AATATACAGAAGATAAGCAGTAGGATTTGCAAGTTTAAAAGAATATCTTAAAATTCAAAA
ATTCAAAAGAGATACTTTAAAGAGTGTCAGAGATTACTTTTAGTAAAATACTCTTTTAAA
GTGCTTTAAATATTGGAATTATGGATGCTCTAAAGCAGATGAAGACATTCATAAATATCT
CCGTTTAAGAAATTGTTTCTTAAATTGGAGAAATGGTTTAGATAGGAATAATGATTTAAA
CATGAAAAAAATAACTCTTTTTAGAGTTCATTCTCTCTTAAAGTGGAATTTTATCAGACT
TAAAAAAATAGTTGAATTTGAAAAGCTCAATTCTATGGCAAAAAAGTTTCATCTTTTCTA
AATTTTTCATGCTTTCTGCATAGTGGTTAGGAAAAATAAGTTTAAATAATATAAAAAGAG
AAAGGCTCTCCATTACTTTAAAAATTAGCACTCATTTTTTCTAAAGAAGAGGATATTCTA
GCTTTTCAAGAAAGCCGTCTCAATAAGCCAAGAAGAAAGGTTTAAAGATGAGGCAGGTAA
ATATATAGATTATTTTTTTTATTATCTACTTTTATATTCCTTCCAAATAATTTTGTCGAA
AATTAAAGCTTTATGAGGCTTTAGGAAGCAATTTTTGATAGAATTATTATTATTTTTGAC
ATTTTTTAAATATTATTCATTAAAAAGTGAATTCTTATTATGAGAGTAAAGAGAAGGAGA
GATTGGCTTTGTAAACATTTTAAAGGTTAAAATTGAATGTTAAGATTAATAAAGCAGAAA
GACACAGAAAAAATAAACTGCAAAAGAAGTCACTTTAGAGGTGGAGGGAGTTTAGATAAG
TTTCTATTGAGAGAAAAAGATTAATTGTCTTGAAAATTTTTAACAGAAAAAAAGATCTGA
TTGAAAAATCTTTCTTTTTCTTAAAAAAGTATGCAATTAATTAATTGATTGAATAATTTA
AAAAAGCTTTTAATTTGCAAAAATAAAAAAGGTTTGTAGAATACAGAAGGGCTAAACTAA
AAATGGCTGTTTAATATTATCAAAAGAGGATGATGAGAACTTCTTTATATAATTGGCTTG
GAAATATTGTTAATGACTATCTGCTTAAACAAGTAGATGCAGACAATTACTACAAATTTA
AAATTAAGTTAAGATGTTTCCAACAATTAGAAAAGAATAAAAATATTTAACAAAGAAAAA
AATTAATTGAAACAAGAATAATTAACTTTTAAAATAAACAAGAAGATATCTTGTTATGGA
GAAGCTTTTAGAAATTTAAAGGTATGATAGTGTCCATTTTACGGCATAAAAAATACAACT
ATGATTTAGTTAATTCTGTATTTTATAATTGGAAATTATTGATAAAGATGAAAAAGATAT
ACTGA