Identifiers and Description

Gene Model Identifier

TTHERM_00522830

Standard Name

SFR13 (Sfi1 repeat protein)

Aliases

PreTt12398 | 65.m00216 | 3717.m00095

Description

cortical row and undulating membrane basal body localization; predicted to have 51 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( PF08457 ) Sfi1 spindle body protein
  • ( PF07465 ) Photosystem I protein M (PsaM)
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR00088 ) tRNA (guanine-N1)-methyltransferase
  • ( TIGR00161 ) conserved hypothetical protein TIGR00161
  • ( PF08674 ) Acetylcholinesterase tetramerisation domain
  • ( TIGR00042 ) non-canonical purine NTP pyrophosphatase, rdgB/HAM1

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00522830

WebApollo

Fullscreen View

Tetrahymena Stock Center

  • ( SD03294 ) Micronucleus: cen2-1[Δ::NEO2]
  • ( SD03295 ) Micronucleus: cen2-1[Δ::NEO2]
  • ( SD03296 ) Micronucleus: cen2-1[Δ::NEO2]
  • ( SD03297 ) Micronucleus: cen2-1[Δ::NEO2] Macronucleus: SFR13 rescue in two parts
  • ( SD03298 ) Micronucleus: cen2-1[Δ::NEO2] Macronucleus: FLAG-SFR13 rescue in two parts

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12822.19.997093137033517e-262hypothetical protein (2890 aa)

General Information

Paragraph NoGene NameParagraph Text
48SFR13The gene prediction is incorrect. The cDNA sequence, as determined by RT-PCR, is: ATGGCATCCTTATTTAGGAGCGAGGAGCAAGCAATTTAAGAAATTATAAAGCTTATCCCTAACAATAGCGAAGACATATCAATTTTCGATATTTTGAAAGCTTACGATACATATATAGAGGAAAGTGGAATTAGCTTTGAAGATCCTTTTGCATATGATGTTTATGAAATTATCATTCATGCATCTAGAAGAGCACAAGACAATCAACTTAGGAGTTTGTTGACAAATTACAAAGAAATATAAAAATTAAAAATGAAATAAAACAGAAAAAATTCTGGGTATTCTGACAATAGTGATAACTCAGAGAAACCATATTCAAAGCAAAAGTTAGCCAAGTAAAAAATATCAAGCAAGTTCAGCAGTAAAAATTAGTCACTTTCACCAACCAACTTTGGTGTGAATAATTAAAAAAATGATAGAAAAGAATACAACATATAGTTTAAAAATTTTGATACCAGCTCAGGTGAAGAAAACGATAATAATTTTGTAAATAAAGAAATAAATGAAATATAAGATATTGAGCATACTCCTAGCTCTCAATATGAATAATAATAAGTGAGAGGAAGACTTGGATAATACCAACAATTTGCATCTAAAATTATTAATTCAGGTTTGAAAATGTCTAATCCTTTTAATGATAATTTATATAGATATGCAACAGAATAAGCAGATTAGCCTAATCGTTATAGCATTAGAAAGTATAGCTACTCTCCAAACAATAAAATGGATAGTAATAATAATCTAAAAAGGTCAGCATCTCCTATTTGTCATCCTAATAATAGAAGCCTTTCACCTCACTTAAACAATTCAAAACTCTCTAACTACCAAGCAAGATTAAACACTAGTAATTCTCACAATAATTCATTTAATAGTAGTGTTAATTAGCAATAGTCTTAAAGAGTAAGATTTAATACACAGAATGCTGATGAATATGTCAATATTTAAAGCCCTTTAAATTCAATTAACAACTTTTAGGCCAACAGATAGATGAAAGGTAATTTGGAGCAAATATAATAAAGAAGATTTATCTAAGAAAATTAGCACTAAACTCTCAATAGATCCATTGATAATTCAGATTTAAATTCAAAGGTAAATGGCATAGATAATAAAAAATATTTATCATTAGAACCTAAAGATTATCAATAATATTAATTTATGCCAGCTAATCATAAAAAATATTTATCTCTTGATTCAAGCACTAAACAAATGCTTAAGTATGAAAATTAAGATAACGAAAAATAAAACTAAGAAAATGTGTAGTACAATTTTGAAAATAGACACAGAAGTATTGAGGAAATAGAGGAAGATATTGATTTAGTTAGAAATGAAATGGCTCAAGGATTAAGAAGAAAATGGGTACTACATTACCATTTTGCAAACTGGAAAGATTATATTTAAAGATGGAAAGGAGCAACTGAATACATAAATAAGGAGGAATAAGTAGAAAATTTTATTAAAATCAAGATTTAAAGGAAATTTTTCGAAAAATGGGAATAATATGTATAAGAAGAAAATACTTGGAAAGAAGCAAAATTAAATTTTGTTATGAAAAAAAGATAGAATATTTTAAGAAAATGCTTCAATGAATTAAGAGATAGATTAAATGATGGAAAAATTGATAAATATACTTATTATGCAGCAAAATACAAAAAAGAATAAGTTTTAAAGGAAAAGTACTTTTAAAAATTTTTATAGTTCTCCAGAAATCATAGATCAAATAGGTTAAAATTGGAAAGGACACAATAAACTGCCTAAAATAACTTAAAAAAACTAGCTTTTAATCATTTAAAATAGTTAAAATCTGAAAAAAAAGAACGCCAGATAATAAAAGATGATATTAAAATGAAATAAAGTCTGCTTGAAAAGAAAATATCATTTGACAGATTTATTAATAATATAAGATCCATTCTTTGTTTTAAGAAGAAAAAAGAAATACTCAATAAAGCTATAGAAATATAGTTAAAATAGCATTCTCTTTTATCTATGATAGATAACTTTAGAATCATTAAGTATTTCAAAATTTAAGATCAAAGAGCAAGTGAATTTTATAATAAAAATTTATCATCTAAGTTTTTCTATCACTTGAAGTTATTTTTATTTAATAACAGAGAAAGAGTTGAAAATACAGAGAGCTATAATTAACTTAGAATTATAAATAAGCATCATAAATAATGGCAAAAATTTGTTTAACTGAATAAAAGTAAAGAATAAAAATACAAAGATGCGAGAATTCTTTACTTTTTGTATAGAATGATGATTATGATATTAAATGATAACGATTACTAAATTAGTCAGTAAAGAAATATTCAATTTGAGGCTTTTAAAGAATAAGTTTTATACTTATAAAAAATGAATTAAATACTTAATAATTAGCAATAAAAAGAAAATTATTAGTCTTTTGGTAAAGGAGAGAGCGAAGATGAATAAATTGATCCCACTCACTAATCTATGATGCAAAACTCAAGTAGCAATAATAATTTAATGTCAAATCATAAAAAATTACTGCCTAACTAAAAGAGTAAAAATTATTTATTCTCTAGAAGCACTCAAGCAACAGCTATGGGGAATAATGTTAATCCAAATCAAGTTTTTGATACTGTTAGATCCTTCTCTCCTGCCCCTGCAAGATAACATGATAATAAAACTTCTAGAAATGAAAACCATAATCAAGATTAATAATTCTTATCAGAAAATGACTAAAGCGATAATCAGCGTATGCAAAGAAATCTATCTGAATAAAATTTTGTTTATTAAACTCAAAGATAGTCTTAGAGCAATATACTAAAAGTATATGAAAATTAAGAGATGATGAATGAGTAATAAATAAATGAAGAAATTGCAATTTAAATAATAGGACATGGAATATTTTTTACTTATCCTAGTATACTATCTATAAATTATTATAACAAAACTCAAACAGAAAAATTATTTTAATCTCATAGAAATTTAAATCAATTCATTTTAAGTAAGTCTTTTAAGAATTGGGTGACTTTCTTAAGATCAAGAAATGACTTTAGAAAGAAGATGTTAAATAAAATTTATTAAAAACATTTTGATGCCATGAAAATTTATTCTACAAAATCTTAATGTTTAAGATTTTGTGTTGAAAAAATGCAGAAAAAGCTAAATAAAAAGACTGTCGAAAATGTTTTTAGAGAAATGAGTTTAAGAGCTTAAGAGAGAAAAAATTCAAGAAATGGTTTTAAAATAATAAGAGAAAAGATAGAGAAAAAATTACTTTAAAAATACTTTAAGATTTATAGAAGAGAATTTTCTTCATCACGTGGATATTCTGAAAACTATGAATAAGCTGGCATTTATTATAAAAAATGGCTTATTGTTTAATCTTTCCAAGCTATCTAAAATTATGCAAATAGATAAAAAATGGTAAGAGATGTCATTTCAACAAAATTCTAAACTAAAAGCTAAAACTAAATGAGTAGAATATTCTTTGCCTGGAGAATTTATTCTGATAAAAGAAGATAAAGAAACTTTATATATTAACAAATTAGATAGATATATGAAAAAAAGGTTTATAAAGAATGTTTATTTGCATTAGCAAATTATAGAGATAAACACTCAAAGTCAACAAAGAATAAAAATATTGTGAAATCTTATTTGTTTAACAAATATATTGTGAACACTTTCTAAAAAATACTAAATTATTCTAAAAGTCATAAAATAAAAAGTATTTTGACTGATAAAATTAGAATTGCATATAAGCAAAAGCTTATGTAGAATTATCTCCATAAACTTAAAGATTATAAAAATTATAGACAAAAGAAAGTAACTCTCCAAGCAAAAAATACTGAGAAAGTAGAAAAAGTATTTCAAAAAAAGCATTTTAGGGCTTGGTACAAGCTAGGATGTAGAAATTAAAGCTTCCGTTACTTAGTTGATTTAGTAAAAAGACTATAATTAAGTAGATTTTTTGTTATCATGAAATATTTACGTTAAAGGGATTTCTAAAAGCAAAAAATTATTAAAAGTGATCATCTAATCTTCTTAAAATTAACTATTTTTAATGCTTTTGTTAAGTATTACAGAAAAAGAAAATATGAAAGAAAGAGTCTTGAATATATAAAATGTAGATAACAAATTAATTATGCCAAGTAATCTATGAAGTAATGGAAGAAATTGCATTCATACAATAAAAATGTAACATATTTATGTGCAAAGTCAATCATAGCTATCAAAAACGAAATACTTTTAAAGTACTTTAATAAACTTAAATAAAAATGGTTCTTAAAATCATAAGAAAACAAGTTTATAAAGGAAAATCAAATTAAGATGAAGAGAAAAATCTTACTTGGATTAAGAAAATATACAACTTATAAAATAAATAACTATGAAAACATGATAGCTATCAATGAAAAAAGAAAGAAATAGATTAAATAAAACATTCTATATATTTGGCTCAGAAAGTTATTTAATAAATAGCGTCAAGAAGACGTCTCTAGGGCTATTATTAAATACAGAAA
49SFR13The continuation of the cDNA sequence is: GCATAAAGTACTTCAAACTTGGGCTGATTTGTTTAACATCAAAAATAACCTACATAATCCAGTTAAAGTTTCTGATTTTCAAGGATTTAAGAGATTAGAAGAAACATAAGAAATACATATCATCACAACAAATAGAGGCAAAAAAAGAAACTTAAGATAGTTTTTCTTTAATATGTTGAAATTAAATTAAAAAATTTTACAACAAAAAGTCTTTTCATGTTTAAAAAACTTAATTAATGAAAGAAAAATTGAGAATAAAAAATCAGATTAAATTTAATTTAAATGTGAAACTGATTTATTAACAAAGTACCTTCTGCAATGGTAAAAATCTAGTCAAAAGAAAATAAATAAGTATAATATGATAGTAAAATTACGAAGTGTATTTTAAAAGTATTAAAAGAGGATTGGGTTTGAAGCTATTTAAGGATAAGAATAAATTTATTTGGAATTAATACAAAAATCCAAAAAGGCTGTAACTTAAAGACAAAAATCCATTAAAATGAAAAGTTTTAACAAGCTTAAAGCATACTATCTTAAGAAAAGAAAAATAGCTAAGAGAAAGCTGGAACTTGATGAACTTGTATAGAGAAATAACACTCTAAATTTCTTTAAAAAGCTAAAGTTTTATGCATATAAAAAGTAGGAAAATAAATAAAAGAATGTATATATCTAAGATTATTTATACTTAAATTTGCTTAAAAAGGTGTTTAATAAGATAAGAACATACTAAATAATTAAGTAGACTTTAGCTTAAAAATCTCTTAAACTTTAATCTTACTTAAATAAAAAGAAGCTTAGAAGAGGATTTAAATAAATTTAATAAAACTTTTCTGAAAGTAAAAGTGATATGTAAAATACCATTTAATCATTAAAGGCTTACAGAATGAATCTTCAGCTTAAATCATTCGCTGTTCTAAGAAAATACATGAATATTTAAAAATTGAAAAGCTAAAAATATAATAGTGCTTTTAATAAATATTATTTTAGTTTAGCTACAAGAATATTTGGAGCATTAAAGACATATATACTCAATAAAAATATTGAAAAAGATAATCATTTGTATATCCTTGATTAATATCGTTAAAGAAAATAAGTCGAAATAAAGAAGGGAATTTTGATGGTTTGGAAATACTACACTAATTAAAGTATAAATCAAGTCTAGCAATTTAGGTCTTGCATTGAAGCTTCAGTTCTAAAATCTAAGTTTGTTGAATGGAAGATTAAGACTCATCTTCTCAAAGATAAGAGAATGAAATATAACATTATTAAAAATTCTAATAATTATAAGCTAAGAGCTAAGCTATTCAAATTATGGTAGTAAAGGGCAAAGCTGAATTTAGTCCTTACAAATATTTTTGTCTATCATGCAAAAATAGAAATTAAAAAAAGACTTTTAAAGTGGAATCAATCTAAAAACTTGTTGAAAAAAATAGTGAACAAATCTTAATAACAAGTTATTTCTAAACCTAGATCAGCAGATGATATTTAAAAAATGAGATAAGTATTTTGCATGATCAAAGAAATGGCTTAAAATACACATTCAATTAAGAAGGATTAAAATTTAAGATAAAAGTAAATTAATGACCAAAATGTCTTTAAGTAGTTTACTTTGCAATTTAAAGCTTCATAATTAGCAGAAAAATTAAATCAGCTAAGATACTTCTCTTCTGCTCAATAATTTATTTTTAATCTAAAGCAAATGTACATTTAAAAAAAGTAGGACAAAGCTCTTGCTAAGAAATCTGAAAGACTAAATTCTCCTAAATTCTAAAAAAACTAAATCAAGAATTCCATGATTTAGCAAACTCTTAAAGAACAAAAGTTAAAGGATGAATTTTAAAAGTTAAGTAAATTAATAAGCAGAAAGCAAAAAGAGTTACTCAGTGGTAGCTTGCTAAACTTAAAAGATTTTGTTAACTACTAAAATAATATTTAAATTCAAGCTAATTTACATCATGATAGGTAGCTACAGTAAAAAACTTTCAAACTTTGGAAAAAGTTTGTTGAAAGTTCCAAGCAATTTTCAAGTGTGCTAGGATAGGTGTTAACTAAGGCTTTAAAAAGATGCTAATAATAGAAATTGAGAGATGCTTTTAGATAAATATAAATCAGATATATAAAAATTAAAGCTGCTAATATAGTTTCTAGCTGTATTGATAGATCAGTAAAGCGCTAATACGCTTAAAAATTATTTGAACTTTACGAGTAATTTAAATCAAAAACACAAGTACTAAGATATTTAATTGAAAACCATTAAATAAAAATGAACACATAAAGAGCAATTTAGTTCTTTAACATTCTAAAAAATCTAAAAATTCAAGCTGAACGCTCAAAGATGAAGTGTAAAGAATATCTATTCATTAGAAGAATAAAATAAATGAAATCAGTCTTGACAATATTATAAATCTATACTCAGTATAGAAGAAACAAAAATGACAGATACTAAAAAGCTCATTTATTTTGGGAAAACAAATCCAAATAAAAATACCTTTATTTCTGGGCCAGAGCTTATTAAAACGCCTAACAATATGAGGAATACTAATAAGATCAATTCGATTAGTAAGAATTTTATGAGTAACAATAAAAATTAGTTGAGAATGAACTTATGTAATAATTGGCTTTACACCATCAGCAATAAGTAAACTAATAAGGAAACATTTAGTAACTAACAAAATAAGAGCAAGAAGAGTAGTTGCGTTATCTTTAGCAATAATATGAAATTTTGAAGTAGCAGTAGCAGTAAATGTTGTAAAAATAATAATAAACTTATCACCAATAAAACTAACAACAAAATTAAAGATATCTAAGTAATTAATCAGAATAATTTTAATCTGATGAGAACGAATATTATAATGAAGAACCAGTAACTTACAGTGATGCAAATTACATAAATATACCTATTAACTATAATCCTAATTCCAATTATGATTAAAATATTGGTATTTAGTAAAAAATAAATTAAATTTAGCAAGAGAATAAATATGATTATCAAGACTAAGACATGGCAGATTTACTTTTTGACAAACCAAGATAATATATTCCCTAATAGCAAAGACAGCAAATTTAGAGTTATGAAAACATTTAAAAGCAATCAAACATAATTCAATAAGAACATCTCATTATCAAAGAGCAAAGTGAGGAACATGAGTCAGGTAATGATTCTTAATTGTAAAAGTATTTGAGAGAGTCCTAATCTTATAATTAAGAGAATTAAAATGACTCTTATTAAAATGATCAAGAAAATAAATCTTAAGAAAGAGAAAGTAAAATAGAATCATATTAAATTTAAAGTTAAAATGAGTCATATGAATAAATTCATTCCTACTAACAGTAAGATAAAGATATTCATTAGCATGATCATGAATTAGTTTAATAAAATTAAAACTAAAGTTAAGGATAAGATTAACATGAAGAATAATAATACACATTTAGCTAAGACGAATAAAAAAGTTCATCTAATACATCTAAAAATATTTTAAATAATAATTATGAACAATAACAATAAAATTTAAGTAATTAGTAATAAAATATGATATAATAATAGTAATTAATTCAATAACAGTAGTAGCAACTGTTATAATAGCTCTAGTAGGCTTAACAATAAAAACAAATAAACATGAGCTTTGAGAATATTGATTAAAATTAAGCAGATAAATCTTAAGTAGAGGATTATAAGGAAGATGATTTTTATAATTAAGGCGAATTTTTGGAATAATCTGAAGAAGATTCTTAAGAATAAACAAATTTTATGCTTTAACAATATTTATTATAGAAGCAAGAGTCATTTGTTCAAATGGTCTTCAATGTTTGGCGCAAATTTACTATAGACAAAAAAATTAAAAGAAATTAAGAAGAAGAAGCTATCGAAACAGCTTATTAAGTTTATGAAAATAATTTGAGCAGGAGAGTATTTTTAGAGTGGAAAGAAGTATGCTAAGAAAGAATTAATATGAGCAAGTAACAAATGAGATCCTACTTATATGCTTGCTTTTCAAGCTGGAAAATGTTTTCTAAGGAAAAAAAATTACTAAAAAAATATTTATCTGAAGCTGAGTTGGATGAACAATTAGCCTACACTCCTTAAACAACCGACAGGCTAAATCTTCTTTTTAATAATAACGATCCTAGATCTTCTTAATAAAAATTTTAGAGATCTGGGTCTTATAATAATTTAGAAGGATCTAACAAAACTTCCTCTGATTCATAAAAGAGTGTATCGTTAGCAAGCGCACTCTTTACTGGAAAGCTCAAAATTTAAGATACTTCTAATTTGGATAAAAATGCTCCTCATTGA
50SFR13The predicted protein sequence based on the cDNA sequence determined by RT-PCR is: MASLFRSEEQAIQEIIKLIPNNSEDISIFDILKAYDTYIEESGISFEDPFAYDVYEIIIHASRRAQDNQLRSLLTNYKEIQKLKMKQNRKNSGYSDNSDNSEKPYSKQKLAKQKISSKFSSKNQSLSPTNFGVNNQKNDRKEYNIQFKNFDTSSGEENDNNFVNKEINEIQDIEHTPSSQYEQQQVRGRLGQYQQFASKIINSGLKMSNPFNDNLYRYATEQADQPNRYSIRKYSYSPNNKMDSNNNLKRSASPICHPNNRSLSPHLNNSKLSNYQARLNTSNSHNNSFNSSVNQQQSQRVRFNTQNADEYVNIQSPLNSINNFQANRQMKGNLEQIQQRRFIQENQHQTLNRSIDNSDLNSKVNGIDNKKYLSLEPKDYQQYQFMPANHKKYLSLDSSTKQMLKYENQDNEKQNQENVQYNFENRHRSIEEIEEDIDLVRNEMAQGLRRKWVLHYHFANWKDYIQRWKGATEYINKEEQVENFIKIKIQRKFFEKWEQYVQEENTWKEAKLNFVMKKRQNILRKCFNELRDRLNDGKIDKYTYYAAKYKKEQVLKEKYFQKFLQFSRNHRSNRLKLERTQQTAQNNLKKLAFNHLKQLKSEKKERQIIKDDIKMKQSLLEKKISFDRFINNIRSILCFKKKKEILNKAIEIQLKQHSLLSMIDNFRIIKYFKIQDQRASEFYNKNLSSKFFYHLKLFLFNNRERVENTESYNQLRIINKHHKQWQKFVQLNKSKEQKYKDARILYFLYRMMIMILNDNDYQISQQRNIQFEAFKEQVLYLQKMNQILNNQQQKENYQSFGKGESEDEQIDPTHQSMMQNSSSNNNLMSNHKKLLPNQKSKNYLFSRSTQATAMGNNVNPNQVFDTVRSFSPAPARQHDNKTSRNENHNQDQQFLSENDQSDNQRMQRNLSEQNFVYQTQRQSQSNILKVYENQEMMNEQQINEEIAIQIIGHGIFFTYPSILSINYYNKTQTEKLFQSHRNLNQFILSKSFKNWVTFLRSRNDFRKKMLNKIYQKHFDAMKIYSTKSQCLRFCVEKMQKKLNKKTVENVFREMSLRAQERKNSRNGFKIIREKIEKKLLQKYFKIYRREFSSSRGYSENYEQAGIYYKKWLIVQSFQAIQNYANRQKMVRDVISTKFQTKSQNQMSRIFFAWRIYSDKRRQRNFIYQQIRQIYEKKVYKECLFALANYRDKHSKSTKNKNIVKSYLFNKYIVNTFQKILNYSKSHKIKSILTDKIRIAYKQKLMQNYLHKLKDYKNYRQKKVTLQAKNTEKVEKVFQKKHFRAWYKLGCRNQSFRYLVDLVKRLQLSRFFVIMKYLRQRDFQKQKIIKSDHLIFLKLTIFNAFVKYYRKRKYERKSLEYIKCRQQINYAKQSMKQWKKLHSYNKNVTYLCAKSIIAIKNEILLKYFNKLKQKWFLKSQENKFIKENQIKMKRKILLGLRKYTTYKINNYENMIAINEKRKKQIKQNILYIWLRKLFNKQRQEDVSRAIIKYRKHKVLQTWADLFNIKNNLHNPVKVSDFQGFKRLEETQEIHIITTNRGKKRNLRQFFFNMLKLNQKILQQKVFSCLKNLINERKIENKKSDQIQFKCETDLLTKYLLQWQKSSQKKINKYNMIVKLRSVFQKYQKRIGFEAIQGQEQIYLELIQKSKKAVTQRQKSIKMKSFNKLKAYYLKKRKIAKRKLELDELVQRNNTLNFFKKLKFYAYKKQENKQKNVYIQDYLYLNLLKKVFNKIRTYQIIKQTLAQKSLKLQSYLNKKKLRRGFKQIQQNFSESKSDMQNTIQSLKAYRMNLQLKSFAVLRKYMNIQKLKSQKYNSAFNKYYFSLATRIFGALKTYILNKNIEKDNHLYILDQYRQRKQVEIKKGILMVWKYYTNQSINQVQQFRSCIEASVLKSKFVEWKIKTHLLKDKRMKYNIIKNSNNYKLRAKLFKLWQQRAKLNLVLTNIFVYHAKIEIKKRLLKWNQSKNLLKKIVNKSQQQVISKPRSADDIQKMRQVFCMIKEMAQNTHSIKKDQNLRQKQINDQNVFKQFTLQFKASQLAEKLNQLRYFSSAQQFIFNLKQMYIQKKQDKALAKKSERLNSPKFQKNQIKNSMIQQTLKEQKLKDEFQKLSKLISRKQKELLSGSLLNLKDFVNYQNNIQIQANLHHDRQLQQKTFKLWKKFVESSKQFSSVLGQVLTKALKRCQQQKLRDAFRQIQIRYIKIKAANIVSSCIDRSVKRQYAQKLFELYEQFKSKTQVLRYLIENHQIKMNTQRAIQFFNILKNLKIQAERSKMKCKEYLFIRRIKQMKSVLTILQIYTQYRRNKNDRYQKAHLFWENKSKQKYLYFWARAYQNAQQYEEYQQDQFDQQEFYEQQQKLVENELMQQLALHHQQQVNQQGNIQQLTKQEQEEQLRYLQQQYEILKQQQQQMLQKQQQTYHQQNQQQNQRYLSNQSEQFQSDENEYYNEEPVTYSDANYINIPINYNPNSNYDQNIGIQQKINQIQQENKYDYQDQDMADLLFDKPRQYIPQQQRQQIQSYENIQKQSNIIQQEHLIIKEQSEEHESGNDSQLQKYLRESQSYNQENQNDSYQNDQENKSQERESKIESYQIQSQNESYEQIHSYQQQDKDIHQHDHELVQQNQNQSQGQDQHEEQQYTFSQDEQKSSSNTSKNILNNNYEQQQQNLSNQQQNMIQQQQLIQQQQQQLLQQLQQAQQQKQINMSFENIDQNQADKSQVEDYKEDDFYNQGEFLEQSEEDSQEQTNFMLQQYLLQKQESFVQMVFNVWRKFTIDKKIKRNQEEEAIETAYQVYENNLSRRVFLEWKEVCQERINMSKQQMRSYLYACFSSWKMFSKEKKLLKKYLSEAELDEQLAYTPQTTDRLNLLFNNNDPRSSQQKFQRSGSYNNLEGSNKTSSDSQKSVSLASALFTGKLKIQDTSNLDKNAPH

Associated Literature

  1. Ref:23426847: Stemm-Wolf AJ, Meehl JB, Winey M (2013) Sfr13, a member of a large family of asymmetrically localized Sfi1-repeat proteins, is important for basal body separation and stability in Tetrahymena thermophila. Journal of cell science 126(Pt 7):1659-71

Sequences

>TTHERM_00522830(coding)
ATGGCATCCTTATTTAGGAGCGAGGAGCAAGCAATTTAAGAAATTATAAAGCTTATCCCT
AACAATAGCGAAGACATATCAATTTTCGATATTTTGAAAGCTTACGATACATATATAGAG
GAAAGTGGAATTAGCTTTGAAGATCCTTTTGCATATGATGTTTATGAAATTATCATTCAT
GCATCTAGAAGAGCACAAGACAATCAACTTAGGAGTTTGTTGACAAATTACAAAGAAATA
TAAAAATTAAAAATGAAATAAAACAGAAAAAATTCTGGGTATTCTGACAATAGTGATAAC
TCAGAGAAACCATATTCAAAGCAAAAGTTAGCCAAGTAAAAAATATCAAGCAAGTTCAGC
AGTAAAAATTAGTCACTTTCACCAACCAACTTTGGTGTGAATAATTAAAAAAATGATAGA
AAAGAATACAACATATAGTTTAAAAATTTTGATACCAGCTCAGGTGAAGAAAACGATAAT
AATTTTGTAAATAAAGAAATAAATGAAATATAAGATATTGAGCATACTCCTAGCTCTCAA
TATGAATAATAATAAGTGAGAGGAAGACTTGGATAATACCAACAATTTGCATCTAAAATT
ATTAATTCAGGTTTGAAAATGTCTAATCCTTTTAATGATAATTTATATAGATATGCAACA
GAATAAGCAGATTAGCCTAATCGTTATAGCATTAGAAAGTATAGCTACTCTCCAAACAAT
AAAATGGATAGTAATAATAATCTAAAAAGGTCAGCATCTCCTATTTGTCATCCTAATAAT
AGAAGCCTTTCACCTCACTTAAACAATTCAAAACTCTCTAACTACCAAGCAAGATTAAAC
ACTAGTAATTCTCACAATAATTCATTTAATAGTAGTGTTAATTAGCAATAGTCTTAAAGA
GTAAGATTTAATACACAGAATGCTGATGAATATGTCAATATTTAAAGCCCTTTAAATTCA
ATTAACAACTTTTAGGCCAACAGATAGATGAAAGGTAATTTGGAGCAAATATAATAAAGA
AGATTTATCTAAGAAAATTAGCACTAAACTCTCAATAGATCCATTGATAATTCAGATTTA
AATTCAAAGGTAAATGGCATAGATAATAAAAAATATTTATCATTAGAACCTAAAGATTAT
CAATAATATTAATTTATGCCAGCTAATCATAAAAAATATTTATCTCTTGATTCAAGCACT
AAACAAATGCTTAAGTATGAAAATTAAGATAACGAAAAATAAAACTAAGAAAATGTGTAG
TACAATTTTGAAAATAGACACAGAAGTATTGACGAAATAGAGGAAGATATTGATTTAGTT
AGAAATGAAATGGCTCAAGGATTAAGAAGAAAATGGGTACTACATTACCATTTTGCAAAC
TGGAAAGATTATATTTAAAGATGGAAAGGAGCAACTGAATACATAAATAAGGAGGAATAA
GTAGAAAATTTTATTAAAATCAAGATTTAAAGGAAATTTTTCGAAAAATGGGAATAATAT
GTATAAGAAGAAAATACTTGGAAAGAAGCAAAATTAAATTTTGTTATGAAAAAAAGATAG
AATATTTTAAGAAAATGCTTCAATGAATTAAGAGATAGATTAAATGATGGAAAAATTGAT
AAATATACTTATTATGCAGCAAAATACAAAAAAGAATAAGTTTTAAAGGAAAAGTACTTT
TAAAAATTTTTATAGTTCTCCAGAAATCATAGATCAAATAGGTTAAAATTGGAAAGGACA
CAATAAACTGCCTAAAATAACTTAAAAAAACTAGCTTTTAATCATTTAAAATAGTTAAAA
TCTGAAAAAAAAGAACGCCAGATAATAAAAGATGATATTAAAATGAAATAAAGTCTGCTT
GAAAAGAAAATATCATTTGACAGATTTATTAATAATATAAGATCCATTCTTTGTTTTAAG
AAGAAAAAAGAAATACTCAATAAAGCTATAGAAATATAGTTAAAATAGCATTCTCTTTTA
TCTATGATAGATAACTTTAGAATCATTAAGTATTTCAAAATTTAAGATCAAAGAGCAAGT
GAATTTTATAATAAAAATTTATCATCTAAGTTTTTCTATCACTTGAAGTTATTTTTATTT
AATAACAGAGAAAGAGTTGAAAATACAGAGAGCTATAATTAACTTAGAATTATAAATAAG
CATCATAAATAATGGCAAAAATTTGTTTAACTGAATAAAAGTAAAGAATAAAAATACAAA
GATGCGAGAATTCTTTACTTTTTGTATAGAATGATGATTATGATATTAAATGATAACGAT
TACTAAATTAGTCAGTAAAGAAATATTCAATTTGAGGCTTTTAAAGAATAAGTTTTATAC
TTATAAAAAATGAATTAAATACTTAATAATTAGCAATAAAAAGAAAATTATTAGTCTTTT
GGTAAAGGAGAGAGCGAAGATGAATAAATTGATCCCACTCACTAATCTATGATGCAAAAC
TCAAGTAGCAATAATAATTTAATGTCAAATCATAAAAAATTACTGCCTAACTAAAAGAGT
AAAAATTATTTATTCTCTAGAAGCACTCAAGCAACAGCTATGGGGAATAATGTTAATCCA
AATCAAGTTTTTGATACTGTTAGATCCTTCTCTCCTGCCCCTGCAAGATAACATGATAAT
AAAACTTCTAGAAATGAAAACCATAATCAAGATTAATAATTCTTATCAGAAAATGACTAA
AGCGATAATCAGCGTATGCAAAGAAATCTATCTGAATAAAATTTTGTTTATTAAACTCAA
AGATAGTCTTAGAGCAATATACTAAAAGTATATGAAAATTAAGAGATGATGAATGAGTAA
TAAATAAATGAAGAAATTGCAATTTAAATAATAGGACATGGAATATTTTTTACTTATCCT
AGTATACTATCTATAAATTATTATAACAAAACTCAAACAGAAAAATTATTTTAATCTCAT
AGAAATTTAAATCAATTCATTTTAAGTAAGTCTTTTAAGAATTGGGTGACTTTCTTAAGA
TCAAGAAATGACTTTAGAAAGAAGATGTTAAATAAAATTTATTAAAAACATTTTGATGCC
ATGAAAATTTATTCTACAAAATCTTAATGTTTAAGATTTTGTGTTGAAAAAATGCAGAAA
AAGCTAAATAAAAAGACTGTCGAAAATGTTTTTAGAGAAATGAGTTTAAGAGCTTAAGAG
AGAAAAAATTCAAGAAATGGTTTTAAAATAATAAGAGAAAAGATAGAGAAAAAATTACTT
TAAAAATACTTTAAGATTTATAGAAGAGAATTTTCTTCATCACGTGGATATTCTGAAAAC
TATGAATAAGCTGGCATTTATTATAAAAAATGGCTTATTGTTTAATCTTTCCAAGCTATC
TAAAATTATGCAAATAGATAAAAAATGGTAAGAGATGTCATTTCAACAAAATTCTAAACT
AAAAGCTAAAACTAAATGAGTAGAATATTCTTTGCCTGGAGAATTTATTCTGATAAAAGA
AGATAAAGAAACTTTATATATTAACAAATTAGATAGATATATGAAAAAAAGGTTTATAAA
GAATGTTTATTTGCATTAGCAAATTATAGAGATAAACACTCAAAGTCAACAAAGAATAAA
AATATTGTGAAATCTTATTTGTTTAACAAATATATTGTGAACACTTTCTAAAAAATACTA
AATTATTCTAAAAGTCATAAAATAAAAAGTATTTTGACTGATAAAATTAGAATTGCATAT
AAGCAAAAGCTTATGTAGAATTATCTCCATAAACTTAAAGATTATAAAAATTATAGACAA
AAGAAAGTAACTCTCCAAGCAAAAAATACTGAGAAAGTAGAAAAAGTATTTCAAAAAAAG
CATTTTAGGGCTTGGTACAAGCTAGGATGTAGAAATTAAAGCTTCCGTTACTTAGTTGAT
TTAGTAAAAAGACTATAATTAAGTAGATTTTTTGTTATCATGAAATATTTACGTTAAAGG
GATTTCTAAAAGCAAAAAATTATTAAAAGTGATCATCTAATCTTCTTAAAATTAACTATT
TTTAATGCTTTTGTTAAGTATTACAGAAAAAGAAAATATGAAAGAAAGAGTCTTGAATAT
ATAAAATGTAGATAACAAATTAATTATGCCAAGTAATCTATGAAGTAATGGAAGAAATTG
CATTCATACAATAAAAATGTAACATATTTATGTGCAAAGTCAATCATAGCTATCAAAAAC
GAAATACTTTTAAAGTACTTTAATAAACTTAAATAAAAATGGTTCTTAAAATCATAAGAA
AACAAGTTTATAAAGGAAAATCAAATTAAGATGAAGAGAAAAATCTTACTTGGATTAAGA
AAATATACAACTTATAAAATAAATAACTATGAAAACATGATAGCTATCAATGAAAAAAGA
AAGAAATAGATTAAATAAAACATTCTATATATTTGGCTCAGAAAGTTATTTAATAAATAG
CGTCAAGAAGACGTCTCTAGGGCTATTATTAAATACAGAAAGCATAAAGTACTTCAAACT
TGGGCTGATTTGTTTAACATCAAAAATAACCTACATAATCCAGTTAAAGTTTCTGATTTT
CAAGGATTTAAGAGATTAGAAGAAACATAAGAAATACATATCATCACAACAAATAGAGGC
AAAAAAAGAAACTTAAGATAGTTTTTCTTTAATATGTTGAAATTAAATTAAAAAATTTTA
CAACAAAAAGTCTTTTCATGTTTAAAAAACTTAATTAATAAAAGAAAAATTGAGAATAAA
AAATCAGATTAAATTTAATTTAAATGTGAAACTGATTTATTAACAAAGTACCTTCTGCAA
TGGTAAAAATCTAGTCAAAAGAAAATAAATAAGTATAATATGATAGTAAAATTACGAAGT
GTATTTTAAAAGTATTAAAAGAGGATTGGGTTTGAAGCTATTTAAGGATAAGAATAAATT
TATTTGGAATTAATACAAAAATCCAAAAAGGCTGTAACTTAAAGACAAAAATCCATTAAA
ATGAAAAGTTTTAACAAGCTTAAAGCATACTATCTTAAGAAAAGAAAAATAGCTAAGAGA
AAGCTGGAACTTGATGAACTTGTATAGAGAAATAACACTCTAAATTTCTTTAAAAAGCTA
AAGTTTTATGCATATAAAAAGTAGGAAAATAAATAAAAGAATGTATATATTTAAGATTAT
TTATACTTAAATTTGCTTAAAAAGGTGTTTAATAAGATAAGAACATACTAAATAATTAAG
TAGACTTTAGCTTAAAAATCTCTTAAACTTTAATCTTACTTAAATAAAAAGAAGCTTAGA
AGAGGATTTAAATAAATTTAATAAAACTTTTCTGAAAGTAAAAGTGATATGTAAAATACC
ATTTAATCATTAAAGGCTTACAGAATGAATCTTCAGCTTAAATCATTCGCTGTTCTAAGA
AAATACATGAATATTTAAAAATTGAAAAGCTAAAAATATAATAGTGCTTTTAATAAATAT
TATTTTAGTTTAGCTACAAGAATATTTGGAGCATTAAAGACATATATACTCAATAAAAAT
ATTGAAAAAGATAATCATTTGTATATCCTTGATTAATATCGTTAAAGAAAATAAGTCGAA
ATAAAGAAGGGAATTTTGATGGTTTGGAAATACTACACTAATTAAAGTATAAATCAAGTC
TAGCAATTTAGGTCTTGCATTGAAGCTTCAGTTCTAAAATCTAAGTTTGTTGAATGGAAG
ATTAAGACTCATCTTCTCAAAGATAAGAGAATGAAATATAACATTATTAAAAATTCTAAT
AATTATAAGCTAAGAGCTAAGCTATTCAAATTATGGTAGTAAAGGGCAAAGCTGAATTTA
GTCCTTACAAATATTTTTGTCTATCATGCAAAAATAGAAATTAAAAAAAGACTTTTAAAG
TGGAATCAATCTAAAAACTTGTTGAAAAAAATAGTGAACAAATCTTAATAACAAGTTATT
TCTAAACCTAGATCAGCAGATGATATTTAAAAAATGAGATAAGTATTTTGCATGATCAAA
GAAATGGCTTAAAATACACATTCAATTAAGAAGGATTAAAATTTAAGATAAAAGTAAATT
AATGACCAAAATGTCTTTAAGTAGTTTACTTTGCAATTTAAAGCTTCATAATTAGCAGAA
AAATTAAATCAGCTAAGATACTTCTCTTCTGCTCAATAATTTATTTTTAATCTAAAGCAA
ATGTACATTTAAAAAAAGTAGGACAAAGCTCTTGCTAAGAAATCTGAAAGACTAAATTCT
CCTAAATTCTAAAAAAACTAAATCAAGAATTCCATGATTTAGCAAACTCTTAAAGAACAA
AAGTTAAAGGATGAATTTTAAAAGTTAAGTAAATTAATAAGCAGAAAGCAAAAAGAGTTA
CTCAGTGGTAGCTTGCTAAACTTAAAAGATTTTGTTAACTACTAAAATAATATTTAAATT
CAAGCTAATTTACATCATGATAGGTAGCTACAGTAAAAAACTTTCAAACTTTGGAAAAAG
TTTGTTGAAAGTTCCAAGCAATTTTCAAGTGTGCTAGGATAGGTGTTAACTAAGGCTTTA
AAAAGATGCTAATAATAGAAATTGAGAGATGCTTTTAGATAAATATAAATCAGATATATA
AAAATTAAAGCTGCTAATATAGTTTCTAGCTGTATTGATAGATCAGTAAAGCGCTAATAC
GCTTAAAAATTATTTGAACTTTACGAGTAATTTAAATCAAAAACACAAGTACTAAAATAT
TTAATTGAAAACCATTAAATAAAAATGAACACATAAAGAGCAATTTAGTTCTTTAACATT
CTAAAAAATCTAAAAATTCAAGCTGAACGCTCAAAGATGAAGTGTAAAGAATATCTATTC
ATTAGAAGAATAAAATAAATGAAATCAGTCTTGACAATATTATAAATCTATACTCAGTAT
AGAAGAAACAAAAATGACAGATACTAAAAAGCTCATTTATTTTGGGAAAACAAATCCAAA
TAAAAATACCTTTATTTCTGGGCCAGAGCTTATTAAAATGCCTAACAATATGAGGAATAC
TAATAAGATCAATTCGATTAGTAAGAATTTTATGAGTAACAATAAAAATTAGTTGAGAAT
GAACTTATGTAATAATTGGCTTTACACCATCAGCAATAAGTAAACTAATAAGGAAACATT
TAGTAACTAACAAAATAAGAGCAAGAAGAGTAGTTGCGTTATCTTTAGCAATAATATGAA
ATTTTGAAGTAGCAGTAGCAGTAAATGTTGTAAAAATAATAATAAACTTATCACCAATAA
AACTAACAACAAAATTAAAGATATCTAAGTAATTAATCAGAATAATTTTAATCTGATGAG
AACGAATATTATAATGAAGAACCAGTAACTTACAGTGATGCAAATTACATAAATATACCT
ATTAACTATAATCCTAATTCCAATTATGATTAAAATATTGGTATTTAGTAAAAAATAAAT
TAAATTTAGCAAGAGAATAAATATGATTATCAAGACTAAGACATGGCAGATTTACTTTTT
GACAAACCAAGATAATATATTCCCTAATAGCAAAGACAGCAAATTTAGAGTTATGAAAAC
ATTTAAAAGCAATCAAACATAATTCAATAAGAACATCTCATTATCAAAGAGCAAAGTGAG
GAACATGAGTCAGGTAATGATTCTTAATTGTAAAAGTATTTGAGAGAGTCCTAATCTTAT
AATTAAGAGAATTAAAATGACTCTTATTAAAATGATCAAGAAAATAAATCTTAAGAAAGA
GAAAGTAAAATAGAATCATATTAAATTTAAAGTTAAAATGAGTCATATGAATAAATTCAT
TCCTACTAACAGTAAGATAAAGATATTCATTAGCATGATCATGAATTAGTTTAATAAAAT
TAAAACTAAAGTTAAGGATAAGATTAACATGAAGAATAATAATACACATTTAGCTAAGAC
GAATAAAAAAGTTCATCTAATACATCTAAAAATATTTTAAATAATAATTATGAACAATAA
CAATAAAATTTAAGTAATTAGTAATAAAATATGATATAATAATAGTAATTAATTCAATAA
CAGTAGTAGCAACTGTTATAATAGCTCTAGTAGGCTTAACAATAAAAACAAATAAACATG
AGCTTTGAGAATATTGATTAAAATTAAGCAGATAAATCTTAAGTAGAGGATTATAAGGAA
GATGATTTTTATAATTAAGGCGAATTTTTGGAATAATCTGAAGAAGATTCTTAAGAATAA
ACAAATTTTATGCTTTAACAATATTTATTATAGAAGCAAGAGTCATTTGTTCAAATGGTC
TTCAATGTTTGGCGCAAATTTACTATAGACAAAAAAATTAAAAGAAATTAAGAAGAAGAA
GCTATCGAAACAGCTTATTAAGTTTATGAAAATAATTTGAGCAGGAGAGTATTTTTAGAG
TGGAAAGAAGTATGCTAAGAAAGAATTAATATGAGCAAGTAACAAATGAGATCCTACTTA
TATGCTTGCTTTTCAAGCTGGAAAATGTTTTCTAAGGAAAAAAAATTACTAAAAAAATAT
TTATCTGAAGCTGAGTTGGATGAACAATTAGCCTACACTCCTTAAACAACCGACAGGCTA
AATCTTCTTTTTAATAATAACGATCCTAGATCTTCTTAATAAAAATTTTAGAGATCTGGG
TCTTATAATAATTTAGAAGGATCTAACAAAACTTCCTCTGATTCATAAAAGAGTGTATCG
TTAGCAAGCGCACTCTTTACTGGAAAGCTCAAAATTTAAGATACTTCTAATTTGGATAAA
AATGCTCCTCATTGA


>TTHERM_00522830(protein)
MASLFRSEEQAIQEIIKLIPNNSEDISIFDILKAYDTYIEESGISFEDPFAYDVYEIIIH
ASRRAQDNQLRSLLTNYKEIQKLKMKQNRKNSGYSDNSDNSEKPYSKQKLAKQKISSKFS
SKNQSLSPTNFGVNNQKNDRKEYNIQFKNFDTSSGEENDNNFVNKEINEIQDIEHTPSSQ
YEQQQVRGRLGQYQQFASKIINSGLKMSNPFNDNLYRYATEQADQPNRYSIRKYSYSPNN
KMDSNNNLKRSASPICHPNNRSLSPHLNNSKLSNYQARLNTSNSHNNSFNSSVNQQQSQR
VRFNTQNADEYVNIQSPLNSINNFQANRQMKGNLEQIQQRRFIQENQHQTLNRSIDNSDL
NSKVNGIDNKKYLSLEPKDYQQYQFMPANHKKYLSLDSSTKQMLKYENQDNEKQNQENVQ
YNFENRHRSIDEIEEDIDLVRNEMAQGLRRKWVLHYHFANWKDYIQRWKGATEYINKEEQ
VENFIKIKIQRKFFEKWEQYVQEENTWKEAKLNFVMKKRQNILRKCFNELRDRLNDGKID
KYTYYAAKYKKEQVLKEKYFQKFLQFSRNHRSNRLKLERTQQTAQNNLKKLAFNHLKQLK
SEKKERQIIKDDIKMKQSLLEKKISFDRFINNIRSILCFKKKKEILNKAIEIQLKQHSLL
SMIDNFRIIKYFKIQDQRASEFYNKNLSSKFFYHLKLFLFNNRERVENTESYNQLRIINK
HHKQWQKFVQLNKSKEQKYKDARILYFLYRMMIMILNDNDYQISQQRNIQFEAFKEQVLY
LQKMNQILNNQQQKENYQSFGKGESEDEQIDPTHQSMMQNSSSNNNLMSNHKKLLPNQKS
KNYLFSRSTQATAMGNNVNPNQVFDTVRSFSPAPARQHDNKTSRNENHNQDQQFLSENDQ
SDNQRMQRNLSEQNFVYQTQRQSQSNILKVYENQEMMNEQQINEEIAIQIIGHGIFFTYP
SILSINYYNKTQTEKLFQSHRNLNQFILSKSFKNWVTFLRSRNDFRKKMLNKIYQKHFDA
MKIYSTKSQCLRFCVEKMQKKLNKKTVENVFREMSLRAQERKNSRNGFKIIREKIEKKLL
QKYFKIYRREFSSSRGYSENYEQAGIYYKKWLIVQSFQAIQNYANRQKMVRDVISTKFQT
KSQNQMSRIFFAWRIYSDKRRQRNFIYQQIRQIYEKKVYKECLFALANYRDKHSKSTKNK
NIVKSYLFNKYIVNTFQKILNYSKSHKIKSILTDKIRIAYKQKLMQNYLHKLKDYKNYRQ
KKVTLQAKNTEKVEKVFQKKHFRAWYKLGCRNQSFRYLVDLVKRLQLSRFFVIMKYLRQR
DFQKQKIIKSDHLIFLKLTIFNAFVKYYRKRKYERKSLEYIKCRQQINYAKQSMKQWKKL
HSYNKNVTYLCAKSIIAIKNEILLKYFNKLKQKWFLKSQENKFIKENQIKMKRKILLGLR
KYTTYKINNYENMIAINEKRKKQIKQNILYIWLRKLFNKQRQEDVSRAIIKYRKHKVLQT
WADLFNIKNNLHNPVKVSDFQGFKRLEETQEIHIITTNRGKKRNLRQFFFNMLKLNQKIL
QQKVFSCLKNLINKRKIENKKSDQIQFKCETDLLTKYLLQWQKSSQKKINKYNMIVKLRS
VFQKYQKRIGFEAIQGQEQIYLELIQKSKKAVTQRQKSIKMKSFNKLKAYYLKKRKIAKR
KLELDELVQRNNTLNFFKKLKFYAYKKQENKQKNVYIQDYLYLNLLKKVFNKIRTYQIIK
QTLAQKSLKLQSYLNKKKLRRGFKQIQQNFSESKSDMQNTIQSLKAYRMNLQLKSFAVLR
KYMNIQKLKSQKYNSAFNKYYFSLATRIFGALKTYILNKNIEKDNHLYILDQYRQRKQVE
IKKGILMVWKYYTNQSINQVQQFRSCIEASVLKSKFVEWKIKTHLLKDKRMKYNIIKNSN
NYKLRAKLFKLWQQRAKLNLVLTNIFVYHAKIEIKKRLLKWNQSKNLLKKIVNKSQQQVI
SKPRSADDIQKMRQVFCMIKEMAQNTHSIKKDQNLRQKQINDQNVFKQFTLQFKASQLAE
KLNQLRYFSSAQQFIFNLKQMYIQKKQDKALAKKSERLNSPKFQKNQIKNSMIQQTLKEQ
KLKDEFQKLSKLISRKQKELLSGSLLNLKDFVNYQNNIQIQANLHHDRQLQQKTFKLWKK
FVESSKQFSSVLGQVLTKALKRCQQQKLRDAFRQIQIRYIKIKAANIVSSCIDRSVKRQY
AQKLFELYEQFKSKTQVLKYLIENHQIKMNTQRAIQFFNILKNLKIQAERSKMKCKEYLF
IRRIKQMKSVLTILQIYTQYRRNKNDRYQKAHLFWENKSKQKYLYFWARAYQNAQQYEEY
QQDQFDQQEFYEQQQKLVENELMQQLALHHQQQVNQQGNIQQLTKQEQEEQLRYLQQQYE
ILKQQQQQMLQKQQQTYHQQNQQQNQRYLSNQSEQFQSDENEYYNEEPVTYSDANYINIP
INYNPNSNYDQNIGIQQKINQIQQENKYDYQDQDMADLLFDKPRQYIPQQQRQQIQSYEN
IQKQSNIIQQEHLIIKEQSEEHESGNDSQLQKYLRESQSYNQENQNDSYQNDQENKSQER
ESKIESYQIQSQNESYEQIHSYQQQDKDIHQHDHELVQQNQNQSQGQDQHEEQQYTFSQD
EQKSSSNTSKNILNNNYEQQQQNLSNQQQNMIQQQQLIQQQQQQLLQQLQQAQQQKQINM
SFENIDQNQADKSQVEDYKEDDFYNQGEFLEQSEEDSQEQTNFMLQQYLLQKQESFVQMV
FNVWRKFTIDKKIKRNQEEEAIETAYQVYENNLSRRVFLEWKEVCQERINMSKQQMRSYL
YACFSSWKMFSKEKKLLKKYLSEAELDEQLAYTPQTTDRLNLLFNNNDPRSSQQKFQRSG
SYNNLEGSNKTSSDSQKSVSLASALFTGKLKIQDTSNLDKNAPH


>TTHERM_00522830(gene)
ATGGCATCCTTATTTAGGAGCGAGGAGCAAGCAATTTAAGAAATTATAAAGCTTATCCCT
AACAATAGCGAAGACATATCAATTTTCGATATTTTGAAAGCTTACGATACATATATAGGT
TAAAAATTTGAATCATTATTTGCTATTTATTTATGGTTGTTGTACTTTTACAAATTCTTT
TGAATGCATTATTCAATTATTTCCAGTGAAAAAAGTAATTCTTCTTATTTAACATAAAAT
CATAAAAAATTATAGAGGAAAGTGGAATTAGCTTTGAAGATCCTTTTGCATATGATGTTT
ATGAAATTATCATTCATGCATCTAGAAGAGCACAAGACAATCAACTTAGGAGTTTGTTGA
CAAATTACAAAGAAATATAAAAATTAAAAATGAAATAAAACAGAAAAAATTCTGGGTATT
CTGACAATAGTGATAACTCAGAGAAACCATATTCAAAGCAAAAGTTAGCCAAGTAAAAAA
TATCAAGCAAGTTCAGCAGTAAAAATTAGTCACTTTCACCAACCAACTTTGGTGTGAATA
ATTAAAAAAATGATAGAAAAGAATACAACATATAGTTTAAAAATTTTGATACCAGCTCAG
GTGAAGAAAACGATAATAATTTTGTAAATAAAGAAATAAATGAAATATAAGATATTGAGC
ATACTCCTAGCTCTCAATATGAATAATAATAAGTGAGAGGAAGACTTGGATAATACCAAC
AATTTGCATCTAAAATTATTAATTCAGGTTTGAAAATGTCTAATCCTTTTAATGATAATT
TATATAGATATGCAACAGAATAAGCAGATTAGCCTAATCGTTATAGCATTAGAAAGTATA
GCTACTCTCCAAACAATAAAATGGATAGTAATAATAATCTAAAAAGGTCAGCATCTCCTA
TTTGTCATCCTAATAATAGAAGCCTTTCACCTCACTTAAACAATTCAAAACTCTCTAACT
ACCAAGCAAGATTAAACACTAGTAATTCTCACAATAATTCATTTAATAGTAGTGTTAATT
AGCAATAGTCTTAAAGAGTAAGATTTAATACACAGAATGCTGATGAATATGTCAATATTT
AAAGCCCTTTAAATTCAATTAACAACTTTTAGGCCAACAGATAGATGAAAGGTAATTTGG
AGCAAATATAATAAAGAAGATTTATCTAAGAAAATTAGCACTAAACTCTCAATAGATCCA
TTGATAATTCAGATTTAAATTCAAAGGTAAATGGCATAGATAATAAAAAATATTTATCAT
TAGAACCTAAAGATTATCAATAATATTAATTTATGCCAGCTAATCATAAAAAATATTTAT
CTCTTGATTCAAGCACTAAACAAATGCTTAAGTATGAAAATTAAGATAACGAAAAATAAA
ACTAAGAAAATGTGTAGTACAATTTTGAAAATAGACACAGAAGTATTGACGAAATAGAGG
AAGATATTGATTTAGTTAGAAATGAAATGGCTCAAGGATTAAGAGTAAATTAAATCATAT
GATATTAACAAATAAAAACTATTTTATATATTATCAATATAGAGAAAATGGGTACTACAT
TACCATTTTGCAAACTGGAAAGATTATATTTAAAGATGGAAAGGAGCAACTGAATACATA
AATAAGGAGGAATAAGTAGAAAATTTTATTAAAATCAAGATTTAAAGGAAATTTTTCGAA
AAATGGGTAATAAACTAAAAAAAAAATTTTTTTGTTAATATTTTGTTTTAAAATATGTAG
GAATAATATGTATAAGAAGAAAATACTTGGAAAGAAGCAAAATTAAATTTTGTTATGAAA
AAAAGATAGAATATTTTAAGAAAATGCTTCAATGAATTAAGAGATAGATTAAATGATGGA
AAAATTGATAAATATACTTATTATGCAGCAAAATACAAAAAAGAATAAGTTTTAAAGGAA
AAGTACTTTTAAAAATTTTTATAGTTCTCCAGAAATCATGTATTTACTTACTTACTATTT
TATATATTTTTATTTAAACTTATATTTTTATTTTTTAAAGAGATCAAATAGGTTAAAATT
GGAAAGGACACAATAAACTGCCTAAAATAACTTAAAAAAACTAGCTTTTAATCATTTAAA
ATAGTTAAAATCTGAAAAAAAAGAACGCCAGATAATAAAAGATGATATTAAAATGAAATA
AAGTCTGCTTGAAAAGAAAATATCATTTGACAGATTTATTAATAATATAAGATCCATTCT
TTGTTTTAAGAAGAAAAAAGAAATACTCAATAAAGCTATAGAAATATAGTTAAAATAGCA
TTCTCTTTTATCTATGATAGATAACTTTAGAATCATTAAGTATTTCAAAATTTAAGATCA
AAGAGCAAGTGAATTTTATAATAAAAATTTATCATCTAAGTTTTTCTATCACTTGAAGTT
ATTTTTATTTAATAACAGAGAAAGAGTTGAAAATACAGAGGTAATTTAGTTAAAATTTTT
TAATTCAAATTTTAAATATTTTTTAACAAAATTTAGAGCTATAATTAACTTAGAATTATA
AATAAGCATCATAAATAATGGCAAAAATTTGTTTAACTGAATAAAAGTAAAGAATAAAAA
TACAAAGATGCGAGAATTCTTTACTTTTTGTATAGAATGATGATTATGATATTAAATGAT
AACGATTACTAAATTAGTCAGTAAAGAAATATTCAATTTGAGGCTTTTAAAGAATAAGTT
TTATACTTATAAAAAATGAATTAAATACTTAATAATTAGCAATAAAAAGAAAATTATTAG
TCTTTTGGTAAAGGAGAGAGCGAAGATGAATAAATTGATCCCACTCACTAATCTATGATG
CAAAACTCAAGTAGCAATAATAATTTAATGTCAAATCATAAAAAATTACTGCCTAACTAA
AAGAGTAAAAATTATTTATTCTCTAGAAGCACTCAAGCAACAGCTATGGGGAATAATGTT
AATCCAAATCAAGTTTTTGATACTGTTAGATCCTTCTCTCCTGCCCCTGCAAGATAACAT
GATAATAAAACTTCTAGAAATGAAAACCATAATCAAGATTAATAATTCTTATCAGAAAAT
GACTAAAGCGATAATCAGCGTATGCAAAGAAATCTATCTGAATAAAATTTTGTTTATTAA
ACTCAAAGATAGTCTTAGAGCAATATACTAAAAGTATATGAAAATTAAGAGATGATGAAT
GAGTAATAAATAAATGAAGAAATTGCAATTTAAATAATAGGACATGGAATATTTTTTACT
TATCCTAGTATACTATCTATAAATTATTATAACAAAACTCAAACAGAAAAATTATTTTAA
TCTCATAGAAATTTAAATCAATTCATTTTAAGTAAGTCTTTTAAGAATTGGGTGACTTTC
TTAAGGTAAATTAAATACTTATTTAAATATTAAATTAACTAAAATTTATTTTTAGATCAA
GAAATGACTTTAGAAAGAAGATGTTAAATAAAATTTATTAAAAACATTTTGATGCCATGA
AAATTTATTCTACAAAATCTTAATGTTTAAGATTTTGTGTTGAAAAAATGCAGAAAAAGC
TAAATAAAAAGACTGTCGAAGTATGATATAAATTTTACTTTTAGTTCAAATTATTTACTT
ATTTATTTGCTTATTTTGAAAAGAATGTTTTTAGAGAAATGAGTTTAAGAGCTTAAGAGA
GAAAAAATTCAAGAAATGGTTTTAAAATAATAAGAGAAAAGATAGAGAAAAAATTACTTT
AAAAATACTTTAAGATTTATAGAAGAGAATTTTCTTCATCACGTGGATATTCTGAAAACT
ATGAATAAGCTGGCATTTATTATAAAAAATGGCTTATTGTTTAATCTTTCCAAGCTATCT
AAAATTATGCAAATAGATAAAAAATGGTAAAAAATATACTTATTTTTCTTCAAAAGTGTA
AAATATTATAATGAAATAATAGGTAAGAGATGTCATTTCAACAAAATTCTAAACTAAAAG
CTAAAACTAAATGAGTAGAATATTCTTTGCCTGGAGAATTTATTCTGATAAAAGAAGATA
AAGAAACTTTATATATTAACAAATTAGATAGATATATGAAAAAAAGGTTTATAAAGAATG
TTTATTTGCATTAGCAAATTATAGAGATAAACACTCAAAGTCAACAAAGTAAAGCAATAA
TTTTTTATAAGATATTAAAATATTTTTAAAATAAATTTAGGAATAAAAATATTGTGAAAT
CTTATTTGTTTAACAAATATATTGTGAACACTTTCTAAAAAATACTAAATTATTCTAAAA
GTCATAAAATAAAAAGTATTTTGACTGATAAAATTAGAATTGCATATAAGCAAAAGCTTA
TGTAGAATTATCTCCATAAACTTAAAGATTATAAAAATTATAGACAAAAGAAAGTAACTC
TCCAAGCAAAAAATACTGAGAAAGTAGAAAAAGTATTTCAAAAAAAGCATTTTAGGGCTT
GGTACAAGCTAGGATGTAGAAATTAAAGCTTCCGTTACTTAGTTGATTTAGTAAAAAGAC
TATAATTAAGTAGATTTTTTGTTATCATGAAATATTTACGTTAAAGGGATTTCTAAAAGC
AAAAAATTATTAAAAGTGATCATCTAATCTTCTTAAAATTAACTATTTTTAATGCTTTTG
TTAAGTATTACAGAAAAAGAAAATATGAAAGAAAGAGTCTTGAATATATAAAATGTAGAT
AACAAATTAATTATGCCAAGTAATCTATGAAGTAATGGAAGAAATTGCATTCATACAATA
AAAATGTAACATATTTATGTGCAAAGTCAATCATAGCTATCAAAAACGAAATACTTTTAA
AGTACTTTAATAAACTTAAATAAAAATGGTTCTTAAAATCATAAGAAAACAAGTTTATAA
AGGAAAATCAAATTAAGATGAAGAGAAAAATCTTACTTGGATTAAGAAAATATACAACTT
ATAAAATAAATAACTATGAAAACATGATAGCTATCAATGAAAAAAGAAAGAAATAGATTA
AATAAAACATTCTATATATTTGGCTCAGAAAGTTATTTAATAAATAGCGTCAAGAAGACG
TCTCTAGGGCTATTATTAAATACAGAAAGCATAAAGTACTTCAAACTTGGGCTGATTTGT
AATTAAATTTACTTTGAAATTATTAATTAATTTTTATTTTTTACAAATAGGTTTAACATC
AAAAATAACCTACATAATCCAGTTAAAGTTTCTGATTTTCAAGGATTTAAGAGATTAGAA
GAAACATAAGAAATACATATCATCACAACAAATAGAGGCAAAAAAAGAAACTTAAGATAG
TTTTTCTTTAATATGTTGAAATTAAATTAAAAAATTTTACAACAAAAAGTCTTTTCATGT
TTAAAAAACTTAATTAATAAAAGAAAAATTGAGAATAAAAAATCAGATTAAATTTAATTT
AAATGTGAAACTGATTTATTAACAAAGTACCTTCTGCAATGGTAAAAATCTAGTCAAAAG
AAAATAAATAAGTATAATATGATAGTAAAATTACGAAGTGTATTTTAAAAGTATTAAAAG
AGGATTGGGTTTGAAGCTATTTAAGGATAAGAATAAATTTATTTGGAATTAATACAAAAA
TCCAAAAAGGCTGTAACTTAAAGACAAAAATCCATTAAAATGTAAATAAAATATTATTTA
ATTATAAATCTTATTTGTTAAATATAAAACAGGAAAAGTTTTAACAAGCTTAAAGCATAC
TATCTTAAGAAAAGAAAAATAGCTAAGAGAAAGCTGGAACTTGATGAACTTGTATAGAGA
AATAACACTCTAAATTTCTTTAAAAAGCTAAAGTTTTATGCATATAAAAAGTAGGAAAAT
AAATAAAAGAATGTATATATTTAAGATTATTTATACTTAAATTTGCTTAAAAAGGTGTTT
AATAAGATAAGAACATACTAAATAATTAAGTAGACTTTAGCTTAAAAATCTCTTAAACTT
TAATCTTACTTAAATAAAAAGAAGCTTAGAAGAGGATTTAAATAAATTTAATAAAACTTT
TCTGAAAGTAAAAGTGATATGTAAAATACCATTTAATCATTAAAGGCTTACAGAATGAAT
CTTCAGCTTAAATCATTCGCTGTTCTAAGAAAATACATGAATATTTAAAAATTGAAAAGC
TAAAAATATAATAGTGCTTTTAATAAATATTATTTTAGTTTAGCTACAAGAATATTTGGA
GCATTAAAGACATATATACTCAATAAAAATATTGAAAAAGATAATCATTTGTATATCCTT
GATTAATATCGTTAAAGAAAATAAGTCGAAATAAAGAAGGGAATTTTGATGGTTTGGAAA
TACTACACTAATTAAAGTATAAATCAAGTCTAGCAATTTAGGTCTTGCATTGAAGCTTCA
GTTCTAAAATCTAAGTTTGTTGAATGGAAGATTAAGACTCATCTTCTCAAAGATAAGAGA
ATGAAATATAACATTATTAAAAATTCTAATAATTATAAGCTAAGAGCTAAGCTATTCAAA
TTATGGTAGTAAAGGGCAAAGCTGAATTTAGTCCTTACAAATATTTTTGTCTATCATGCA
AAAATAGAAATTAAAAAAAGACTTTTAAAGTGGAATCAATCTAAAAACTTGTTGAAAAAA
ATAGTGAACAAATCTTAATAACAAGTTATTTCTAAACCTAGATCAGCAGATGATATTTAA
AAAATGAGATAAGTATTTTGCATGATCAAAGAAATGGCTTAAAATACACATTCAATTAAG
AAGGATTAAAATTTAAGATAAAAGTAAATTAATGACCAAAATGTCTTTAAGTAGTTTACT
TTGCAATTTAAAGCTTCATAATTAGCAGAAAAATTAAATCAGCTAAGATACTTCTCTTCT
GCTCAATAATTTATTTTTAATCTAAAGCAAATGTACATTTAAAAAAAGTAGGACAAAGCT
CTTGCTAAGAAATCTGAAAGACTAAATTCTCCTAAATTCTAAAAAAACTAAATCAAGTAA
ATATTTATCAATTAATTTTTTAAAAATCCATTTAAATATTTTATTTTATGCAATAAGGAA
TTCCATGATTTAGCAAACTCTTAAAGAACAAAAGTTAAAGGATGAATTTTAAAAGTTAAG
TAAATTAATAAGCAGAAAGCAAAAAGAGTTACTCAGTGGTAGCTTGCTAAACTTAAAAGA
TTTTGTTAACTACTAAAATAATATTTAAATTCAAGCTAATTTACATCATGATAGGTAGCT
ACAGTAAAAAACTTTCAAACTTTGGAAAAAGTTTGTTGAAAGTTCCAAGCAATTTTCAAG
TGTAAATTATTCAAATATTTTAAAATTAGAGAAATTTAAAAATATGTTTTTGTATATGAT
ATATTTTTAGGTGCTAGGATAGGTGTTAACTAAGGCTTTAAAAAGATGCTAATAATAGAA
ATTGAGAGATGCTTTTAGATAAATATAAATCAGATATATAAAAATTAAAGCTGCTAATAT
AGTTTCTAGCTGTATTGATAGATCAGTAAAGCGCTAATACGCTTAAAAATTATTTGAACT
TTACGAGTAATTTAAATCAAAAACACAAGTACTAAAATATTTAATTGAAAACCATTAAAT
AAAAATGAACACATAAAGAGCAATTTAGTTCTTTAACATTCTAAAAAATCTAAAAATTCA
AGCTGAACGCTCAAAGATGAAGTGTAAAGAATATCTATTCATTAGAAGAATAAAATAAAT
GAAATCAGTGTAATTAAAAATAATTTTATCTAAAAATAATAATGAATATTTAAAAATAAT
TTAGCTTGACAATATTATAAATCTATACTCAGTATAGAAGAAACAAAAATGACAGATACT
AAAAAGCTCATTTATTTTGGGAAAACAAATCGTAAATTTTAATAATTTTGCACTAAAATT
AATATTTTTTTTTAAAAGCAAATAAAAATACCTTTATTTCTGGGCCAGAGCTTATTAAAA
TGCCTAACAATATGAGGAATACTAATAAGATCAATTCGATTAGTAAGAATTTTATGAGTA
ACAATAAAAATTAGTTGAGAATGAACTTATGTAATAATTGGCTTTACACCATCAGCAATA
AGTAAACTAATAAGGAAACATTTAGTAACTAACAAAATAAGAGCAAGAAGAGTAGTTGCG
TTATCTTTAGCAATAATATGAAATTTTGAAGTAGCAGTAGCAGTAAATGTTGTAAAAATA
ATAATAAACTTATCACCAATAAAACTAACAACAAAATTAAAGATATCTAAGTAATTAATC
AGAATAATTTTAATCTGATGAGAACGAATATTATAATGAAGAACCAGTAACTTACAGTGA
TGCAAATTACATAAATATACCTATTAACTATAATCCTAATTCCAATTATGATTAAAATAT
TGGTATTTAGTAAAAAATAAATTAAATTTAGCAAGAGAATAAATATGATTATCAAGACTA
AGACATGGCAGATTTACTTTTTGACAAACCAAGATAATATATTCCCTAATAGCAAAGACA
GCAAATTTAGAGTTATGAAAACATTTAAAAGCAATCAAACATAATTCAATAAGAACATCT
CATTATCAAAGAGCAAAGTGAGGAACATGAGTCAGGTAATGATTCTTAATTGTAAAAGTA
TTTGAGAGAGTCCTAATCTTATAATTAAGAGAATTAAAATGACTCTTATTAAAATGATCA
AGAAAATAAATCTTAAGAAAGAGAAAGTAAAATAGAATCATATTAAATTTAAAGTTAAAA
TGAGTCATATGAATAAATTCATTCCTACTAACAGTAAGATAAAGATATTCATTAGCATGA
TCATGAATTAGTTTAATAAAATTAAAACTAAAGTTAAGGATAAGATTAACATGAAGAATA
ATAATACACATTTAGCTAAGACGAATAAAAAAGTTCATCTAATACATCTAAAAATATTTT
AAATAATAATTATGAACAATAACAATAAAATTTAAGTAATTAGTAATAAAATATGATATA
ATAATAGTAATTAATTCAATAACAGTAGTAGCAACTGTTATAATAGCTCTAGTAGGCTTA
ACAATAAAAACAAATAAACATGAGCTTTGAGAATATTGATTAAAATTAAGCAGGTAAATT
TAACAAATATTTTTATTATTTATTTAATGAGTATAAAAAAAAATATTTTTTTGTATATTT
TAGATAAATCTTAAGTAGAGGATTATAAGGAAGATGATTTTTATAATTAAGGCGAATTTT
TGGAATAATCTGAAGAAGATTCTTAAGAATAAACAAATTTTATGCTTTAACAATATTTAT
TATAGAAGCAAGAGTCATTTGTTCAAATGGTCTTCAATGTTTGGCGCAAATTTACTATAG
ACAAGTAAGAATTAAACTTTTTATCCTCATATTTAAAAAGCATTTATAAATTAGAAAAAT
TAAAAGAAATTAAGAAGAAGAAGCTATCGAAACAGCTTATTAAGTTTATGAAAATAATTT
GAGCAGGAGAGTATTTTTAGAGTGGAAAGAAGTATGCTAAGAAAGAATTAATATGAGCAA
GTAACAAATGAGATCCTACTTATATGCTTGCTTTTCAAGCTGGAAAATGTTTTCTAAGGA
AAAAAAATTACTAAAAAAATATTTATCTGAAGCTGAGTTGGATGAACAATTAGCCTACAC
TCCTTAAACAACCGACAGGCTAAATCTTCTTTTTAATAATAACGATCCTAGATCTTCTTA
ATAAAAATTTTAGAGATCTGGGTCTTATAATAATTTAGAAGGATCTAACAAAACTTCCTC
TGATTCATAAAAGAGTGTATCGTTAGCAAGCGCACTCTTTACTGGAAAGCTCAAAATTTA
AGATACTTCTAATTTGGATAAAAATGCTCCTCATTGA