Identifiers and Description

Gene Model Identifier

TTHERM_00999030

Standard Name

SFR12 (Sfi1 repeat protein)

Aliases

PreTt26082 | 189.m00060 | 3819.m00215

Description

oral apparatus fine filamentous reticulum localization and apical filament band localization; predicted to have 29 sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.2%

TetraMine Data

TTHERM_00999030

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_19773.19.997093137033517e-262hypothetical protein (2792 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00999030(coding)
ATGTATAACGAACAGAGAGATTAAATTTAGATAATTTTAAATAGAGCTCTACTCAATCAA
GTAGATCAAAATTATGAGTATAGGAGAGAAATTAATGAATTGAATCAACTTTTATAAAGG
AATTAATATGATAAAAATCAATTCTATGATCTAATGCTTTCAATTATCTAGACTAATCAA
TCAAGGTATAATATAAGAAGCGTGCTTTCTTTTCTATAAATTTGGTAAAACTCCTAAGAT
GGTCAGTAGCAGCCATAAAAAGTTAATTCAAGATAGTTGGCAGCTTTAAATGGTTAGCCA
GTTAATTAATAATAAGAATAATTGAGATTACACAGAATAGGAGCATAAAATCTATGTAGA
TCTCTACTTTAGATTAGATATAATCATATGAGAAATAGTTTTTATCAAATAAGATAAGTT
CAGTTATCATAAGTAAGAAGACATCTTAATTGTAGTCAAAGAATTAAGGGGCAAATCTTA
TAAATGATCTTTTAAAGATATTTCCCCGCTGAACTCAAAAAGAAAGAATTCTTCTATCGT
TGGAGAGTCAGATGCAATATTATTTAACCTAGAAATGTGATAAAAAGATTGGTTTTGTAT
GCAAGAATCCAGCCAGAAATCGCTTATTGGAGACTAAGAAGCTTAATTAGCAATCCTTAT
GAAGATCATATTGTGGGGAAAAAAATTGCTTAGTTTGAAGATATTCTTGAAAATACCAAA
AAAGCTATTTACAAAAAATTTTAGAAGCAAGCTTTTGTCATTTTGTTGAAGAACTAAAAG
AGGCAAAAAAATTTTTTAAGATTATGTGAACTCTTTGAAAAAAAAATGAATAAGCTGTTT
AAAAAAATAGGATTTAGGGTAATAAAGCTAAACTAGAGAGATTATTTAGTCAATAAAAAA
TTTATAGATTTACTTGCAAATTATGCAAAAAAGAAGACTAGAGCACCTTATGATGAAATA
AAAAAAATAAATGAGGAAGGCGAAGAAAAAAAGAAAAGAGCAGTTTATAAAAAACTTAAT
GATAATTTAAAAGTTAATATAACAGAGTGGAGAAAGCAGGCTAATTAGGCTAAATAATAT
ATGAAATGCAGACTTGTTATGAAGTTTTTAGAAACTTTAAATAAAGAACTTGTAGTGAAT
ACAATGTAGATTTTTCAATCAAATAGAGAATAGATTTTGAAAAAATAAGCTATTGAAAAA
ATGTTTGGTAATTTTAACTAATTTGCACGTAAACTTTTAAACACTTGGAGAGTGAATGCA
AGGTTTGGTACACTTAACAGAGACATGATTTAAAGAATGATATAAAATTTAGGTCAACAG
GTTAATAATGGATAAAAAGGAAAAATGAGATCAACTCTAAATTCATTTTATATAAATATG
AAAATCAAAAAAGTTTAACTCAATTTCTTTAAATCCTTATTAGACACAAAAGCTGGTTAA
ATGCTGAGAGTCTTTAGAGTCTGGAAAGAAATTCCTTCTCGTATGACAGGTCCTGCAAAC
AAATTCTAAATTAAACTTTAAAACTTTGCTTTTAAAAGATTAAGAGTATTTTAAGATTCA
ATGAAGTTTCTTTTCTAAGAGGCTGAAAATTAAAAAAAAAGAGCCTTATAAACACTTCTT
CTAAAAACATAATCTTCGTATAAAAGATTATTTATTGAATGGAAATAAATGGTGTACACT
GATAGAATGATTAGAAGATGCAAACTAGTCATAAATATCTTCGAAAGAGTTGAGCAAGTT
ATTTAGGCAAACACATAAATGTTATTCACTGATGACCAAAAAATTAGAAGAATGACAGCT
ATTGTAGAGAAAATGATTGAACAATGGAAGAAGAAAAATTACAATTATTTCTTTAGATGG
AGATAAATTAACCACGAATTAAAAATGGAGGAGCTCCTTAATGATAACAATAAAAAAGAT
ATGCTTAAAAAAATGGTAGATTATGTTAAGAGAAGCTCTGGAAACTCTCATAGATTCGTT
CTTCGTTAATTTTATACCAATTACAAAGTCAAGAATATTTAACAAAAGATCTTCAAAGCT
CTCTTTGATACATCTGCAGGAAAAGTTCTTCATCTCTTTATGCTTTGGAAAGGTCTTCCA
CCTCCAAGCGATAACGAAATGTAAATAAAAACTGTAAGATTTGAAGGTATCTTGCATAAC
TTTTCTATGAGACCTATTAAAAAATCTTTTTAAGCTTTCACAAGAATTTATTAAGAAGCT
ATTTCAAGAAAAAAAAGTTTCTTTCAGAGTCTACAAAAGAAATCTATGTCATCACATAAA
AGAATGTTCATAAACTGGCATTAAATAGCTGATAATTGTAAAAAAGTAAGTAGATGCAAA
AAGACTATGATGTTGTTTGATATTATGAATGATTTACTCTCTTAAAAAGTGGAATTTGCT
CTATTTAGCTCTTTACCTGACTATGATAGGAAGATAAGAGCAATGTAAAAATTAATTGAA
AATTACCAAAGGCTTAGAAAAGAATTCTGGATTATGTGGAAGAGCAGGATAAACGATTTC
AGGATAAAAGATGAATAGAAAGGTGAAGCAATCAAATAATTGGAAGATCTTTTGGATGAC
AAAGTAAAGAGATAGATGAAATAAGCATTATAAAGCTTTGATGTTGACAAGAAGCTCTAA
AAAATTGCATTTAATTTATATAAAAAGCTGGGTGTTACTTCCAGTTAAATGGCTCTTCAG
CTTTTCCTCAAGTGGAAATATCTTCCTTACAGACCCCCTAAAACAATTTCTCACTATTTT
GAAGAAAAAATGAGAGGTTTTGTAAACAATAGAAACAGATAATTTTTAGATTGCTTGAAG
GAAATAAAAAGCCAAGCTGATGAAAAGAAAAAAAATCTGATTATTCTCTTTTTACAAAAT
TAAAAATCTAAATTTTAAGGAGTTTATGATAGCTGGAACTATAAAAGAGAAGACTAAGCA
GTTTAAAAATGTTCTTTAACCATAAAATTATTTGATGCTATCCATATTAAGCTTTAATAA
TAGTTTGGAGTTATAGCTGAAAGCAGAAATTGGGATTTGATGCAAAAATACCTTTAAAGA
TTGATAAATCAATAAAATTTAAATATAAAATTCTGCTTGAAATAATGGCGATAACATGTA
TTTGATTCTAAGATAGATCTTGAAACTAAGCGTAGAATCATTGAAAAATTAAATTTAATG
AAGGAAGGATCAACTTTAGGCGGATAGAGAAAAGTTCTAAATTAATTTATGAAAAATAGA
AACATCAAAATAATCTAAAATTAATTTTTCAGTAAACTCTTAGATACTTCAGTAGGAAAG
ACTTTATCATTATTTTAAAAATGGAAATCACTACCTCTTCCTAGCTCTGAGAAAATCAAG
GCATAGAGATTTGAAAGACTTCTTAATGATTTCAGTGGAAGAAGACTCAGATAATTCTTT
GATCCATTAAAATAATCATTGGTTAAGAGTTAATTAATTCAAAAAGACTCTATCTATCGT
CTAATCAATTTAACTATGAGTGACCACAAAAAACTGTTCCTAAAATGGTCAAACCAAACA
AAATAATACAAGTAGAATTCAAAATGCAGATAAACTTTGAATCTTTTTGCCATCCTTCAA
GAAAAACTCACTGAAAGATTCCATTAAGCTATTGAGAATAACAGGGAAAATAATTTAAAA
AGAAAAGTTATTGAAAGATTATTTGAAGAACAAAGAAGAAGAACTCAAAATGCATTTTCT
ACTTGGAGCCAACTTGTGAGAAGTGTTATGTAAGCTGAAAAATGCAAGAGGACAATTGAC
TTCTTTGAATAGATGGTTGTTGCTCTAAGATCAAGAACTGATGTTATTCTTTTAAATTCA
TAAACTGTAGCTATTAAAAAAAGAGCTCTGGAGAGATTGTTTGAAGTTACAAGAAGTAAA
ACTGTTAGAGCGTTTAGAACTTGGTATTAGTATATGCTTTACAATAGATTAGATGACAAA
TAAAAGAGGAAAATGATTGATATGCTCAGAAATGCAATAACTCATTCGAAAGGCAATAAA
GTCAGATAAGCTATTCAAAGTTTCAAGAAAAATGCTTCAATTCGTAAATATTAGATCCAG
TTCTTCAATAAAATACTGCAATCTAATATTGGCTAGTAGATTCTTTGTTTCTAAAAGTGG
AAATCGCTGCCGATTCCAGTTAACTTCGAAGAAAGGCGTAAATATGCTTCCTTTTAGCAA
AGAATGGCTAATATATACACAAATCCAATAAAATAGAGCTTGTAAGCACTTAAAGATATA
AAATATGTTGCAGAAATTACTAAAAAGAAAGCACTTTACTTGATGCTTAAAAAGACTATG
GGTGTGCCTCAAAGACTCTACATAAAATGGAAAAATGTTACTTAAGATGAAAAAAGAGTT
GAACATTTTAATGCAGTGAGTAGATTCTTTGAGATAGTTAATTAGAAAATCACAGGAAGT
TTAGAAAACACTATAATTGAAAAAACTGGCTCAGCTTCTCACAATTAAAAAATATAAAAA
CTTGTCATATTATTCTAGAGAGTCGAAAGCTTATATAAGAAAACTCTAAACGACTCCATG
CATATGATCTAAAGAAAATCTGGTAGCGTAGCACTTAGAGCTTATTTCGCATCCCTTTGG
AAATGGAAATTTGCAAATTTAGATTCAAAATACTATACAAAATATAAATAAATTTATAGA
TAATCTGCAATTCTCTCCAGATTTGTCTAAATTGTGTAAGCAAGAATTACAAACAACTTA
CAAGATGGATATAAAGAAATCAAAAACTTCAAAAAGAAGAGTAAAGAACAGCTCCTATTG
AATTGTATTGGCATTAGATAAAGAGAGGAAGTCAGATTATAATCAGCATGGCTTAACAGA
TGGAGACAAAATGTTAATTTGATGAGATATTAACAAAATATTATGACTGTTATGATTCAC
CAAAAACTGAACAGTACTGTATAAATCTTAAGTCGTTTGTTGAAACAAGCAGCAATGAAT
AGAATAAAAAACTTCGTGTTTACAATTAGATCAAATAAATCTTAGTAAGTTGAAAACTTG
GTTGCGGTCATTAAAAGGGCTAGATAAAGATAATTATAATCTTCCTTTGAAGCAATTCGT
AATGAAAGTTATTCAAATAGAATTACACGTAAGCTTTATCTCATAAATAGAGGTTTAATC
AAACTTTGTGAATCTAATACGATAAAGCAACAACTTCTAGCTTATGCTTTTGATGCAATT
TACGATTCTGCCTATGATTAAAATGTTAATGTTTGGGAATAAAGAACCTTTTAACAAATG
TTTTGTTTATCAGATATTGCTACTTCATTTAATATTCTAAAAAATTTGGCTTTCCCTTAA
CAGGATACATAAAATTCTCCTCCTCCTTCTCCACCATCTACTCCAATAAACTCAAGGGTA
AACAACAATTATATGGCTCCTAGACATCCAGAGTATAACAATAGTAATTAAAGAAATAAC
TAGTATCTATAGTAAATACCATAACAGTACTAGGATAACTTATCAAATTCTTTGACAAGC
TCATATTAATAACCTCCTGAAATTAGAGTTACAACATCTGCTCTCGTAGCTTAGCATTTA
CTTGAACCATCCTTATAATAATCTATCTAGCTCAATTAAAATAGAAATCAACCTTAAATA
CAGGAGATAGAAGACAATAGTATAAGTGGAATCCTGAAGAAAATAGGTTAAGATAATTTA
AGAATCATCAATCGTTATGGTGCCTCTGATCATATTTATAGTGTGCTACAAAGAATATTT
TAAAGATAAAAATCTTCCATATTCAGATAACTCGTTATTAAAAGCAAAAATAAAACAGTG
GTTGAGCTTAGATTTGAATAGTAAAAAACTAAAAGTTAAATTAACGATTTATAAAATTCT
AATAGGAAATTAGAAAATTAATTATAAAACTCTGAAATAAATTACTAAAACAAGATTTAA
TAGTTAGAGTAATAACTCAATTCGGCAATAGTTAAGTCAGAGTCTTTACTTTCTCAAGAG
AAATAATAACATTAACGCTATATCTAGTAGTTATAATAATAAAACTAATAGCAATAACTA
GAGCTTTAAGATTAAAGAAGGTAAAACTAGGAAATGCAATAAGCAATCCAATAAAGATTA
TATGAAGAAGATAATTAGGAAGCAGACTAATTATAAAGAAGTAGCAGACATTAAAGCGAT
TAAGAAGAGTATGAAAGAAGATCTCTTCACTAACTAGATTAACTAGAAGAAGAAGATTAG
CAAAGAGACAATTAATATTTAAATCAAGTTTCTGATGTTTAATATACTTTGTAAGAAATG
GAAAGTAGAATTTAAGAGCTGATGGCAAGAGATGAAGAAGCATAAAGACAGCATCAATAA
ATATTGGAGGATGAGCAAAATTATGATCATGGAGAATACAATAACAATTACTCTGATTAG
CCATAGCTATCTTTAAGAATTAGATTATAATATGCTGATTAAAATGATCCAAGATATTCT
AATTAACAATAACAATAATCTCTTTTATCACAAAGATCTCAACAACATTAATACTTCTAA
TCTCCTGCTAGCACTTAATTCAGAAATGATGGTAATTTAAGTAGTAGATCCTAAGGATAT
CCTTATGTAACAGGAGATGATTAAATAGACGAAGATCTTATTTAGTACTAAAACAATATG
GCTGATTAGTAGCCAGATGAAATTTAAGATCTATAGAATTTAAATTTATAATTAACAGTA
ACAAAAATTAATTAACTAATTCGCATATTTAATGATCTAAGAACAAGAAATTACAGATTT
GCTTTTTATAAAATTAAAAATTAATTATACCAATCAAATTGA


>TTHERM_00999030(protein)
MYNEQRDQIQIILNRALLNQVDQNYEYRREINELNQLLQRNQYDKNQFYDLMLSIIQTNQ
SRYNIRSVLSFLQIWQNSQDGQQQPQKVNSRQLAALNGQPVNQQQEQLRLHRIGAQNLCR
SLLQIRYNHMRNSFYQIRQVQLSQVRRHLNCSQRIKGQILQMIFQRYFPAELKKKEFFYR
WRVRCNIIQPRNVIKRLVLYARIQPEIAYWRLRSLISNPYEDHIVGKKIAQFEDILENTK
KAIYKKFQKQAFVILLKNQKRQKNFLRLCELFEKKMNKLFKKIGFRVIKLNQRDYLVNKK
FIDLLANYAKKKTRAPYDEIKKINEEGEEKKKRAVYKKLNDNLKVNITEWRKQANQAKQY
MKCRLVMKFLETLNKELVVNTMQIFQSNREQILKKQAIEKMFGNFNQFARKLLNTWRVNA
RFGTLNRDMIQRMIQNLGQQVNNGQKGKMRSTLNSFYINMKIKKVQLNFFKSLLDTKAGQ
MLRVFRVWKEIPSRMTGPANKFQIKLQNFAFKRLRVFQDSMKFLFQEAENQKKRALQTLL
LKTQSSYKRLFIEWKQMVYTDRMIRRCKLVINIFERVEQVIQANTQMLFTDDQKIRRMTA
IVEKMIEQWKKKNYNYFFRWRQINHELKMEELLNDNNKKDMLKKMVDYVKRSSGNSHRFV
LRQFYTNYKVKNIQQKIFKALFDTSAGKVLHLFMLWKGLPPPSDNEMQIKTVRFEGILHN
FSMRPIKKSFQAFTRIYQEAISRKKSFFQSLQKKSMSSHKRMFINWHQIADNCKKVSRCK
KTMMLFDIMNDLLSQKVEFALFSSLPDYDRKIRAMQKLIENYQRLRKEFWIMWKSRINDF
RIKDEQKGEAIKQLEDLLDDKVKRQMKQALQSFDVDKKLQKIAFNLYKKLGVTSSQMALQ
LFLKWKYLPYRPPKTISHYFEEKMRGFVNNRNRQFLDCLKEIKSQADEKKKNLIILFLQN
QKSKFQGVYDSWNYKREDQAVQKCSLTIKLFDAIHIKLQQQFGVIAESRNWDLMQKYLQR
LINQQNLNIKFCLKQWRQHVFDSKIDLETKRRIIEKLNLMKEGSTLGGQRKVLNQFMKNR
NIKIIQNQFFSKLLDTSVGKTLSLFQKWKSLPLPSSEKIKAQRFERLLNDFSGRRLRQFF
DPLKQSLVKSQLIQKDSIYRLINLTMSDHKKLFLKWSNQTKQYKQNSKCRQTLNLFAILQ
EKLTERFHQAIENNRENNLKRKVIERLFEEQRRRTQNAFSTWSQLVRSVMQAEKCKRTID
FFEQMVVALRSRTDVILLNSQTVAIKKRALERLFEVTRSKTVRAFRTWYQYMLYNRLDDK
QKRKMIDMLRNAITHSKGNKVRQAIQSFKKNASIRKYQIQFFNKILQSNIGQQILCFQKW
KSLPIPVNFEERRKYASFQQRMANIYTNPIKQSLQALKDIKYVAEITKKKALYLMLKKTM
GVPQRLYIKWKNVTQDEKRVEHFNAVSRFFEIVNQKITGSLENTIIEKTGSASHNQKIQK
LVILFQRVESLYKKTLNDSMHMIQRKSGSVALRAYFASLWKWKFANLDSKYYTKYKQIYR
QSAILSRFVQIVQARITNNLQDGYKEIKNFKKKSKEQLLLNCIGIRQREEVRLQSAWLNR
WRQNVNLMRYQQNIMTVMIHQKLNSTVQILSRLLKQAAMNRIKNFVFTIRSNKSQQVENL
VAVIKRARQRQLQSSFEAIRNESYSNRITRKLYLINRGLIKLCESNTIKQQLLAYAFDAI
YDSAYDQNVNVWEQRTFQQMFCLSDIATSFNILKNLAFPQQDTQNSPPPSPPSTPINSRV
NNNYMAPRHPEYNNSNQRNNQYLQQIPQQYQDNLSNSLTSSYQQPPEIRVTTSALVAQHL
LEPSLQQSIQLNQNRNQPQIQEIEDNSISGILKKIGQDNLRIINRYGASDHIYSVLQRIF
QRQKSSIFRQLVIKSKNKTVVELRFEQQKTKSQINDLQNSNRKLENQLQNSEINYQNKIQ
QLEQQLNSAIVKSESLLSQEKQQHQRYIQQLQQQNQQQQLELQDQRRQNQEMQQAIQQRL
YEEDNQEADQLQRSSRHQSDQEEYERRSLHQLDQLEEEDQQRDNQYLNQVSDVQYTLQEM
ESRIQELMARDEEAQRQHQQILEDEQNYDHGEYNNNYSDQPQLSLRIRLQYADQNDPRYS
NQQQQQSLLSQRSQQHQYFQSPASTQFRNDGNLSSRSQGYPYVTGDDQIDEDLIQYQNNM
ADQQPDEIQDLQNLNLQLTVTKINQLIRIFNDLRTRNYRFAFYKIKNQLYQSN


>TTHERM_00999030(gene)
ATGTATAACGAGTAATTCATCATATTAATTAGTATTATTTTTTGATGACATTTTTATCTA
TTATATATAGACAGAGAGATTAAATTTAGATAATTTTAAATAGAGCTCTACTCAATCAAG
TAGATCAAAATTATGAGGTAACTAACTCTTTATTAGCAAATATAGAAAGTATTAATGAAT
ATTTCGTCAATTTAATCTAGTATAGGAGAGAAATTAATGAATTGAATCAACTTTTATAAA
GGAATTAATATGATAAAAATCAATTCTATGATCTAATGCTGTAACTTATTAAACATACAT
ACTTTTAGCCTTTGTGTATTTAACTTTATTTTCAAAAATAGTTCAATTATCTAGACTAAT
CAATCAAGGTATAATATAAGAAGCGTGCTTTCTTTTCTATAAATTTGGTAAAACTCCTAA
GATGGTCAGTAGCAGCCATAAAAAGTGTAATTAAAAATGCTTTTTAATTTTAACGAAATA
AATGTATTCTTTAATATAAAAATAAAGTAATTCAAGATAGTTGGCAGCTTTAAATGGTTA
GCCAGTTAATTAATAATAAGAATAATTGAGATTACACAGAATAGGAGCATAAAATCTATG
TAGATCTCTACTTTAGATTAGATATAATCATGTAAATTAGTTATCTAAAATTAATAATTA
TGCTAAAATTCAGTTTATAAAAAATAATAGATGAGAAATAGTTTTTATCAAATAAGATAA
GTTCAGTTATCATAAGTAAGAAGACATCTTAATTGTAGTCAAAGAATTAAGGGGCAAATC
TTATAAATGATCTTTTAAAGATATTTCCCCGCTGAACTCAAAAAGAAAGAATTCTTCTAT
CGTTGGAGAGTCAGATGCAATATTATTTAACCTAGAAATGTGATAAAAAGATTGGTTTTG
TATGCAAGAATCCAGCCAGAAATCGTAAATACAAGCTTTTAAAATTCTTTCTATTAAAAA
AATAAAATTATTTGTGAGATTCTTAACTCACTTATTTGTTTGCTTTTAAGAAATCAATTG
TTGTTGTTTAAAAAATGTAAAGAATTTAAGTTAGAAAATAAATATTTTTTTTTATATCCA
AAGATAATTGATAGCTTTCAAAAAAATAAAATTTATCGTTATTTTTTAAATTCTAATTTT
TTAATTTCAAATTATACGAGAAAACAGCTTTATTTAATTTATATTTTTTAATAAAAGGCT
TATTGGAGACTAAGAAGCTTAATTAGCAATCCTTATGAAGATCATATTGTGGGGAAAAAA
ATTGCTTAGTTTGAAGATATTCTTGAAAATACCAAAAAAGCTATTTACAAAAAATTTTAG
AAGCAAGCTTTTGTCATTTTGTTGAAGAACTAAAAGAGGCAAAAAAATTTTTTAAGATTA
TGTGAACTCTTTGAAAAAAAAATGAATAAGCTGTTTAAAAAAATAGGATTTAGGGTAATA
AAGCTAAACTAGAGAGATTATTTAGTCAATAAAAAATTTATAGATTTACTTGCAAATTAT
GCAAAAAAGAAGACTAGAGCACCTTATGATGAAATAAAAAAAATAAATGAGGAAGGCGAA
GAAAAAAAGAAAAGAGCAGTTTATAAAAAACTTAATGATAATTTAAAAGTTAATATAACA
GAGTGGAGAAAGCAGGCTAATTAGGCTAAATAATATATGAAATGCAGACTTGTTATGAAG
TTTTTAGAAACTTTAAATAAAGAACTTGTAGTGAATACAATGTAGATTTTTCAATCAAAT
AGAGAATAGATTTTGAAAAAATAAGCTATTGAAAAAATGTTTGGTAATTTTAACTAATTT
GCACGTAAACTTTTAAACACTTGGAGAGTGAATGCAAGGTTTGGTACACTTAACAGAGAC
ATGATTTAAAGAATGATATAAAATTTAGGTCAACAGGTTAATAATGGATAAAAAGGAAAA
ATGAGATCAACTCTAAATTCATTTTATATAAATATGAAAATCAAAAAAGTTTAACTCAAT
TTCTTTAAATCCTTATTAGACACAAAAGCTGGTTAAATGCTGAGAGTCTTTAGAGTCTGG
AAAGAAATTCCTTCTCGTATGACAGGTCCTGCAAACAAATTCTAAATTAAACTTTAAAAC
TTTGCTTTTAAAAGATTAAGAGTATTTTAAGATTCAATGAAGTTTCTTTTCTAAGAGGCT
GAAAATTAAAAAAAAAGAGCCTTATAAACACTTCTTCTAAAAACATAATCTTCGTATAAA
AGATTATTTATTGAATGGAAATAAATGGTGTACACTGATAGAATGATTAGAAGATGCAAA
CTAGTCATAAATATCTTCGAAAGAGTTGAGCAAGTTATTTAGGCAAACACATAAATGTTA
TTCACTGATGACCAAAAAATTAGAAGAATGACAGCTATTGTAGAGAAAATGATTGAACAA
TGGAAGAAGAAAAATTACAATTATTTCTTTAGATGGAGATAAATTAACCACGAATTAAAA
ATGGAGGAGCTCCTTAATGATAACAATAAAAAAGATATGCTTAAAAAAATGGTAGATTAT
GTTAAGAGAAGCTCTGGAAACTCTCATAGATTCGTTCTTCGTTAATTTTATACCAATTAC
AAAGTCAAGAATATTTAACAAAAGATCTTCAAAGCTCTCTTTGATACATCTGCAGGAAAA
GTTCTTCATCTCTTTATGCTTTGGAAAGGTCTTCCACCTCCAAGCGATAACGAAATGTAA
ATAAAAACTGTAAGATTTGAAGGTATCTTGCATAACTTTTCTATGAGACCTATTAAAAAA
TCTTTTTAAGCTTTCACAAGAATTTATTAAGAAGCTATTTCAAGAAAAGTAAAGAATTTT
CATATTTATTTTTATTTTACAATTCTCATTAAAAAATCCACTTAAAACAAACTTGACTAA
ATAAATATTTTAATTATTTGATCAAATCCAAAAAATTAATTTAATAAAGCCAGTTTTATT
ATTTACTTTATTTTGAACTTTAAGGTGGACTTTTTATTTTTTGATAAATATTAATAATGC
TTTCATTCACTAACTTTTCATAATAATTATTATATAACTTTACTTAATTTTAATCCTTAG
AAGCTAATTTACTTTATGAGTTATTTTTTCTTTTATTGTTGATAATTAAAGCATATTTTT
AACAATAGAAAAGTTTCTTTCAGAGTCTACAAAAGAAATCTATGTCATCACATAAAAGAA
TGTTCATAAACTGGCATTAAATAGCTGATAATTGTAAAAAAGTAAGTAGATGCAAAAAGA
CTATGATGTTGTTTGATATTATGAATGATTTACTCTCTTAAAAAGTGGAATTTGCTCTAT
TTAGCTCTTTACCTGACTATGATAGGAAGATAAGAGCAATGTAAAAATTAATTGAAAATT
ACCAAAGGCTTAGAAAAGAATTCTGGATTATGTGGAAGAGCAGGATAAACGATTTCAGGA
TAAAAGATGAATAGAAAGGTGAAGCAATCAAATAATTGGAAGATCTTTTGGATGACAAAG
TAAAGAGATAGATGAAATAAGCATTATAAAGCTTTGATGTTGACAAGAAGCTCTAAAAAA
TTGCATTTAATTTATATAAAAAGCTGGGTGTTACTTCCAGTTAAATGGCTCTTCAGCTTT
TCCTCAAGGTATTTTATAATTTTTATTTAATTACCAAACATTTTTTTATTAATCTTTTCT
TTTGATAAATTTAAGTGGAAATATCTTCCTTACAGACCCCCTAAAACAATTTCTCACTAT
TTTGAAGAAAAAATGAGAGGTTTTGTAAACAATAGAAACAGATAATTTTTAGATTGCTTG
AAGGAAATAAAAAGCCAAGCTGATGAAAAGAAAAAAAATCTGATTATTCTCTTTTTACAA
AATTAAAAATCTAAATTTTAAGGAGTTTATGATAGCTGGAACTATAAAAGAGAAGACTAA
GCAGTTTAAAAGTAATTTTATCAAAATAATAGCTAATTTAAATTTTTTGTTTTTAAATAA
AAATAGATGTTCTTTAACCATAAAATTATTTGATGCTATCCATATTAAGCTTTAATAATA
GTTTGGAGTTATAGCTGAAAGCAGAAATTGGGATTTGATGCAAAAATACCTTTAAAGATT
GATAAATCAATAAAATTTAAATATAAAATTCTGCTTGAAATAATGGCGATAACATGTATT
TGATTCTAAGATAGATCTTGAAACTAAGCGTAGAATCATTGAAAAATTAAATTTAATGAA
GGAAGGATCAACTTTAGGCGGATAGAGAAAAGTTCTAAATTAATTTATGAAAAATAGAAA
CATCAAAATAATCTAAAATTAATTTTTCAGTAAACTCTTAGATACTTCAGTAGGAAAGAC
TTTATCAGTAATTTTTTATTTATTTATTTTTTAATTTATAAATTTTATTCAATAGCAATG
AAAAATTAATAAAAATTAATTTATGGCAATTTGAATGATTTAATTAAAATAGATATCTTT
GATTTTTTGATTTTAAATATAAATTCTTTTTTTTAGTTATTTTAAAAATGGAAATCACTA
CCTCTTCCTAGCTCTGAGAAAATCAAGGCATAGAGATTTGAAAGACTTCTTAATGATTTC
AGTGGAAGAAGACTCAGATAATTCTTTGATCCATTAAAATAATCATTGGTTAAGAGTTAA
TTAATTCAAAAAGACTCTATCTATCGTCTAATCAATTTAACTATGAGTGACCACAAAAAA
CTGTTCCTAAAATGGTCAAACCAAACAAAATAATACAAGTAGAATTCAAAATGCAGATAA
ACTTTGAATCTTTTTGCCATCCTTCAAGAAAAACTCACTGAAAGATTCCATTAAGCTATT
GAGAATAACAGGGAAAATAATTTAAAAAGAAAAGTTATTGAAAGATTATTTGAAGAACAA
AGAAGAAGAGTAAACAAATAATTTATTTTTATATTTAAAAATTTTTTAATTCTTTTTTAT
TTTATAAAATTAACCAATTTAGACTCAAAATGCATTTTCTACTTGGAGCCAACTTGTGAG
AAGTGTTATGTAAGCTGAAAAATGCAAGAGGACAATTGACTTCTTTGAATAGATGGTTGT
TGCTCTAAGATCAAGAACTGATGTTATTCTTTTAAATTCATAAACTGTAGCTATTAAAAA
AAGAGCTCTGGAGAGATTGTTTGAAGTTACAAGAAGTAAAACTGTTAGAGCGTTTAGAAC
TTGGTATTAGTATATGCTTTACAATAGATTAGATGACAAATAAAAGAGGAAAATGATTGA
TATGCTCAGAAATGCAATAACTCATTCGAAAGGCAATAAAGTCAGATAAGCTATTCAAAG
TTTCAAGAAAAATGCTTCAATTCGTAAATATTAGATCCAGTTCTTCAATAAAATACTGCA
ATCTAATATTGGCTAGTAGATTCTTTGTTTCTAAAAGGTAATTTCGATTTATTTTATTTT
TAGAAAAAATTAAAATTAATTTTAAAAATAGTGGAAATCGCTGCCGATTCCAGTTAACTT
CGAAGAAAGGCGTAAATATGCTTCCTTTTAGCAAAGAATGGCTAATATATACACAAATCC
AATAAAATAGAGCTTGTAAGCACTTAAAGATATAAAATATGTTGCAGAAATTACTAAAAA
GAAAGCACTTTACTTGATGCTTAAAAAGACTATGGGTGTGCCTCAAAGACTCTACATAAA
ATGGAAAAATGTAAATTCAAAAAATAAATAAGATTTTATTTTAAATTTTTTAATTATTTT
CAAAATTTTAGGTTACTTAAGATGAAAAAAGAGTTGAACATTTTAATGCAGTGAGTAGAT
TCTTTGAGATAGTTAATTAGAAAATCACAGGAAGTTTAGAAAACACTATAATTGAAAAAA
CTGGCTCAGCTTCTCACAATTAAAAAATATAAAAACTTGTCATGTAAAAATTATACTTTG
TTCAGAATTATTTATTTAGCTTACAAATAATATTTTAAAAGATTATTCTAGAGAGTCGAA
AGCTTATATAAGAAAACTCTAAACGACTCCATGCATATGATCTAAAGAAAATCTGGTAGC
GTAGCACTTAGAGCTTATTTCGCATCCCTTTGGAAATGGAAATTTGCAAATTTAGATTCA
AAATACTATACAAAATATAAATAAATTTATAGAGTAAATAATTTTTTTTAGTTTTATATT
TAATTTATTGGTTATGAAATTAGTAATCTGCAATTCTCTCCAGATTTGTCTAAATTGTGT
AAGCAAGAATTACAAACAACTTACAAGATGGATATAAAGAAATCAAAAACTTCAAAAAGA
AGAGTAAAGAACAGCTCCTATTGAATTGTATTGGCATTAGATAAAGAGAGGAAGTCAGAT
TATAATCAGCATGGCTTAACAGATGGAGACAAAATGTTAATTTGATGAGATATTAACAAA
ATATTATGACTGTTATGATTCACCAAAAACTGAACAGTACTGTATAAATCTTAAGTCGTT
TGTTGAAACAAGCAGCAATGAATAGAATAAAAAGTAATTTTAATTGAAAAAAATACATTT
TTTTTATAAAATATTCATTCAAAACATTTTAATTGGATTAATTGATGATAGTCCAAATTT
TTTGCAGATAAAATTTGATATAATTTTTTTCAGTTAAAATTTGATTTAAATTTTTACATT
TTTTTATTTCAGTAAGATATAAATAAATTTCACTTTTACTAATTAAAATTACTCAAATAT
TTTTCAATGAGAGATGATATTTTTTTACTATTTTTTAAAATATATAAAAAATAATTTAAT
GAATAGACTTCGTGTTTACAATTAGATCAAATAAATCTTAGTAAGTTGAAAACTTGGTTG
CGGTCATTAAAAGGGCTAGATAAAGATAATTATAATCTTCCTTTGAAGCAATTCGTAATG
AAAGTTATTCAAATAGAATTACACGTAAGCTTTATCTCATAAATAGAGGTTTAATCAAAC
TTTGTGAATCTAATACGATAAAGCAACAACTTCTAGCTTATGCTTTTGATGCAATTTACG
ATTCTGCCTATGATTAAAATGTTAATGTTTGGGAATAAAGAACCTTTTAACAAATGTTTT
GTTTATCAGATATTGCTACTTCATTTAATATTCTAAAAAATTTGGCTTTCCCTTAACAGG
ATACATAAAATTCTCCTCCTCCTTCTCCACCATCTACTCCAATAAACTCAAGGGTAAACA
ACAATTATATGGCTCCTAGACATCCAGAGTATAACAATAGTAATTAAAGAAATAACTAGT
ATCTATAGTAAATACCATAACAGTACTAGGATAACTTATCAAATTCTTTGACAAGCTCAT
ATTAATAACCTCCTGAAATTAGAGTTACAACATCTGCTCTCGTAGCTTAGCATTTACTTG
AACCATCCTTATAATAATCTATCTAGCTCAATTAAAATAGAAATCAACCTTAAATACAGG
AGATAGAAGACAATAGTATAAGTGGAATCCTGAAGAAAATAGGTTAAGATAATTTAAGAA
TCATCAATCGTTATGGTGCCTCTGATCATATTTATAGTGTGCTACAAAGAATATTTTAAA
GATAAAAATCTTCCATATTCAGATAACTCGTTATTGTAATCATTTTTTTAAATTCTTTAT
TTTTTCAACTAAATTTTTTCATTAATAATTTAGAAAAGCAAAAATAAAACAGTGGTTGAG
CTTAGATTTGAATAGTAAAAAACTAAAAGTTAAATTAACGATTTATAAAATTCTAATAGG
AAATTAGAAAATTAATTATAAAACTCTGAAATAAATTACTAAAACAAGATTTAATAGTTA
GAGTAATAACTCAATTCGGCAATAGTTAAGTCAGAGTCTTTACTTTCTCAAGAGAAATAA
TAACATTAACGCTATATCTAGTAGTTATAATAATAAAACTAATAGCAATAACTAGAGCTT
TAAGATTAAAGAAGGTAAAACTAGGAAATGCAATAAGCAATCCAATAAAGTAATTTTTAT
TTTTTTCTCTAAAAAACCATTTATTTATTTAAACTTAAACTTATCTAAAAATAAAATTTA
ATCTTAGGATTATATGAAGAAGATAATTAGGAAGCAGACTAATTATAAAGAAGTAGCAGA
CATTAAAGCGATTAAGAAGAGTATGAAAGAAGATCTCTTCACTAACTAGATTAACTAGAA
GAAGAAGATTAGCAAAGAGACAATTAATATTTAAATCAAGTTTCTGATGTTTAATATACT
TTGTAAGAAATGGAAAGTAGAATTTAAGAGCTGATGGCAAGAGATGAAGAAGCATAAAGA
CAGCATCAATAAATATTGGAGGATGAGCAAAATTATGATCATGGAGAATACAATAACAAT
TACTCTGATTAGCCATAGCTATCTTTAAGAATTAGATTATAATATGCTGATTAAAATGAT
CCAAGATATTCTAATTAACAATAACAATAATCTCTTTTATCACAAAGATCTCAACAACAT
TAATACTTCTAATCTCCTGCTAGCACTTAATTCAGAAATGATGGTAATTTAAGTAGTAGA
TCCTAAGGATATCCTTATGTAACAGGAGATGATTAAATAGACGAAGATCTTATTTAGTAC
TAAAACAATATGGCTGATTAGTAGCCAGATGAAATTTAAGATCTATAGAATTTAAATTTA
TAATTAACAGTAACAAAAATTAATTAACTAATTCGCATATTTAATGATCTAAGAACAAGA
AATTACAGATTTGCTTTTTATAAAATTAAAAATTAATTATACCAATCAAATTGA