Identifiers and Description

Gene Model Identifier

TTHERM_00421190

Standard Name

SFR11 (Sfi1 repeat protein)

Aliases

PreTt07243 | 46.m00298 | 3679.m00148

Description

cortical row and undulating membrane basal body localization; predicted to have 11 Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02524 ) KID repeat
  • ( TIGR00158 ) ribosomal protein L9
  • ( PF08457 ) Sfi1 spindle body protein
  • ( PF04394 ) Protein of unknown function, DUF536
  • ( TIGR00864 ) polycystin cation channel protein
  • ( TIGR01636 ) phage transcriptional regulator, RinA family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00421190

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10953.19.997093137033517e-262hypothetical protein (1672 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00421190(coding)
ATGAATAAATTTTAGTCTCCTTAATCTCTTCCAAAGAAAACAGTTTAGTTTGAGTCTTCT
TCTTAGCAATAAAGAAGCACAATGTAAAAATTACAAGAAACTGCAAATTCAGATTTGAAT
CATCTCACTGCATCTTTCGGAATGACTGAACTGCAATAAGGTGGTTTTAAAAATCTTCTC
AAAAATAATAATAATAATATTTTAATGCAAGAAAAAAATCAAGACTTACCAAGGATATAC
AATAATGTTTATTCACCAGAAATGATCATTAAAGATGATATTAACCAGAGAGATGAATCA
TATGATAATATAATTGATAATTATTAGTATAAATAGTAATAAGCTAATTAAGAGTTGATC
TAAAATCCAAATGAACTCTATTCTAAATCATAGGAATATAATGAAGACACCTTACACCAA
CAATAAATACTATAGCAATAAAACTAATATATCTTAGAATAATAACAGTATCAATAATAG
TAAAATGCTAACAGCTCTAGAAATAAAAATTATAAAGGATCTCATAGGTAAAATCCTATG
AAAGACTCAAAAATTCAGACATATCTTTAGTAAATGATGAATAACACTAACTATTTAAAA
AATACTGAAAATTCTATTAATAATTTTACTTCTTAGCCAAGTGCTATGTCGGCTTATGAA
GGTTCGTAAATGTTATAAAATTTTTAATCTGAAGACAATGAAATGCAAAGAAACAATCCT
CCTCCTTAACCTGAAAGTTTGGGTATGGTTCAACTAACGTACGGCGAAATAGCTCATCTC
AAGCAAAAATAAAGATAGCTTTCTGAAGAAAAAATAAAAGCCTCAAAATAAAAAAAATTG
CTAGATGAAATAGCTCATTTTTATAGGTAATTAGCTGTTAAGAAAAAGGAGGATCAGAAT
AATAGATCAATTGTAACTTCTCCTTCTCCGATTAGAAAATCTAGTAGCACCTCTCGTTTA
AGAAAGAAATCACCATAAAATAACATTATATAAAATAAATAGGTTTTATAATAATCAGAT
AATAGGATCTTACAAAATTCTTAATCTGTAATTAGCACATATAAAGCAGGAGAAAATAAA
ACTCCAAGATAGGATAAATAGTCTACAGTCAAATAAAATATGAGATACCAAGATGAAAAT
CATTCTAAATCTGTTTAATAATTTTAAATCAGTAAAGCAGATACCTTGAATGAGAATCAA
GAAAACTAAACCGATCTACCAAATTAGTTAATTTAAGCAGGAGAGATCTAAGAACATTAA
TAATAGGATATTAACACTATGATGGTTAAAGGAAATATACAAACTAAATCTTAAAACTAA
CTTAAAAAATCTTAGGAGCTTTAATATGAAAAGATTACTTAATTACAAAAGAATGCTTTA
AAAAAACCAACTCAAGCAAATAATAGGTTTTTAAATTAAAATGGGTCAGCCTTATCAATT
GATTTTGAATCATAGTAAATTATATCTTTAAGCAATATATTTATTCTAAATCCAGTTTAA
TTCTAAGCGCTTGAAAATAAAATAAAAAAATATGATATCAGCTTGATAAAATAAAACATT
ATTTAGAAGTACAGATTTTTAATAGAAAAGGTTAAGTTTTCTAATGAAACACAAAACTAT
TTGAGTACATTAAAAGATTTGTTTAATGAACATAAGATAATGAGTTTTTATGATATGAAC
ATGTTAGAAAAAATTTAAGTTGTAAATAAATTATCTATTAAGGACATATTCTCAAATATA
AAAGAAACAATAGACCTAACTGACTCATATGAAACTATCACTCAAGATATTCAATAAATA
TAAGCTAATTAAAATAATAGAAAGCATTTAAAAACCACAATTTAATAAGAAAAAGAGCTC
TAAACATTACAGGTACTTAAAGATATGTAAATGAGAATGGCTTAAAAAATATTTTTTATA
TATCTTTTCAAAGTATAGTCTGGATACAAAAAAGAAATTATTAAATAATTAGATAGCTTT
GAAAAGGTATAAAATGAACTAAGACTTACTCTCACTTTTAACATGATTAAATACTTCGCC
AAAATTAGATCCTATAAAAATTAACTACAAAAAATTACGAAGCAAGAAATACAGCTAAAA
AAACTAAAGAAAATCTTTGATGCTATAAAATAAAAAAGCAATAAAAATATATATTATAAA
CCTTTCATCTAAGCTATCAGATCAAATAGAAGAAAAGTTTTAAAGCAAAATTCACTTTAT
GCTCTATTTGAATATTGTTAAAGCAAAAAAAGTGAAAAGAAATAACTCTATCTGAGCCAA
TAAATATACAACTCTCATTTAATTACTAAGTCTTATTTAATTTTAAAAGCTTTTTGTAAT
AGAAAAAAAAATAATACAAGCATATAAACTATGACAGCTAAAAATATTTCCATTTAGTAT
ATTCTTGAATTAAAATCTGTAGTATTGCAAGCCGGTTCTTCTTTCAGAGTAAGATAAGAA
TTGTAAGATTATAATTTATAAGATGAACATTTTGAAGAAAAATCTCATAAAATGTATCAA
AACCGACAATAGAATATTTTATCTGGACAAAATGATGATGGAGAAGAATACAATAACCAA
GAAGCTACTATATAAAATTAATTCAATATTTTAGATAATTAATTTATTGATGAAAACTAA
TAATTCAAATAATCAGAAAATAAATCTTAAATAGTTAAGAAGTAGCTAAATTTTTAGGAA
TATGATGACCAATTTTGTGAAGAGGATGTTTCATACGATAGTAAGTAATTTTAAAAGCAT
TTCTACTGTGAAGAAGAATTCTTAAGCAGTGCAAGAAATTTGTTAGATACCAAGAGATAG
ATTGCTTTAGATAAATTAGATAAGTTGAAACATTTAACAGCTTAGAGTGTATAAAATGAA
GATTAATCTTCATTTCTTTAAAAAAACAAAGAGAAAGTTTAGGAAATAATTAGAGAAAAT
TATGAATATTCCAATGAAAAACCATTAAATATTTAAGAATCTGATACTAAGATGAATTTA
GTTTAAATTCCTCCAATTAAGGAAGAGATCTTAAGAGCTGAAAATATTAATTATAATAAA
GAACTTAAAAATTTCGACTAAAGCTTAATTGATGATCAAAATATTTTAGAAGAAGATTGT
AAGTCAATAGTGACTCTTGAATAACATATTAAATAAATCATACGAGTATTAAAAAAGCTT
TCAAAAAAGAAGACAATATTCTAACAAAAAAATCCAGTTCAGCTTTTACTGAATAAAGAT
TCATTTTTCTACTCTTCAGGTGATAATTTATCCAAACAATAAATGAACGGAAAACAATCG
TAAAAGAATATACCACACCCTCTTCAAGAACATCAAGAAATGATTAAACGCATTGAAGAG
AATGAAAAAAAGAAGACAATAAGCTTTTTATTCTATCACTGGAAAATAGTCTTTTTAGAG
AGAACTTTAAATGCAGAAATAACTCTACTAAATTCTCTCAAAAAGTGCAAATCGATTTTA
CAAATATTTAAAAAAAAATACAGAGAAAATAATGAGATTTGTACATTAAAATAATAAATA
AGAGAAGAGAAAATAAAAAGTGAAATATTTTAATCATGGTCATTTATGGCATCTGAAACT
AGCTAAGCAAATTAAGAAAAGCTCTAAATATTTCATAAAAAGTTATGTTTTAGGAGAATT
CTTTACTACTCAACATATAAAAAGATACAGAGAGTAGCTGATGGCATCCATAGAAAAAAT
CTTCAAAAGAAAATTTTAAATTAATGGGACAAAATATCTAAAAGCAATTAAGTTGTTAGA
AAGAAACACAAAAATGCTCTTGTAAGACGCTATTTCAATAACTGGGTTGAATATATTTCA
AAAATCATGTTTTTACGTAAATTTTGGAAAAAAATACTCTACAGCCCAGATGAAATTCTT
TTTGAGAAATATGGAAATAAAAAAAATCTATTGAAACATATTTTGAAATCTTGGAGAGGT
ATAGTTATAGATAATGAAAACACAATGAAGCAAAAACTTGCATTAAAATCTGCAGTTAAT
CACAGGGCAGTTGTTTAAAAGACAAAAGCCTTTTTTTAGTGGGTCAATTTTCTAAACATT
AAAAAAAAGCTATCAAAGATTTTTGAAAGCAAAGTAATTTAAAAGATGTTTGCTAAAAAA
ATATTACAACCTTGGAAGAGTGCTGTAGCAGAATAAAAAAGTGCAATTTCTACATTTAAA
AGGAAAGCGAATATGAATATTAAATTTAAGGCTTTCCATTGCTTGAAAATTAAATATTTA
TAAAATAAGATGGTTGAAAACTGTTTTTTAAAGAAATTTTTCTATAGTTGGAAAGTTTAG
TAATAACATAATTAGGAAATTCTACCCCGCAACTTTTATAGTAGAAAATTAGTAAAAAAA
AGTTTTACTTCAATTATTTACCATCAACTTCTTTAGATGAAAGAGAGAGCTAAAACAGAA
AAGTCAACTAAATTCTTTTTGTATCACATTAAAAAGTTTATGCAAACTTGCCTTCTGCTT
TGGCAAAAACACACATAAAAGAAGAAGAGTAAAAAGCTCTTGAAGATAAAACTTTAAAAG
TATTCTGAAAAAAACATTAAAAAAAGGGCATTCAATTCACTTAAACTCAGAAAGATATAA
TCAAGATTAAAAATTATATAAAACAAAAAGGCTCTTGAATTTAAAGCAATTTAATACTAA
AAGAAGTATGATTTAAAAAGACTTATAACTGACCCCCACTTAAATCCAAAATTGTAAGAA
GTTCTTTAGATAATTCACTACTGGAGAGCTTATGCTATTAAATAAAAGAGTATTAAATTT
ATCTAAGCAAGAATTTAAAAATTCCATAATAGAAAAATATTGATTGAATATTTTACTTCT
TGGTAAAATAAATATAATTAAAAGTTATCTTTAAAAAATTAAGCCTAATTTGAAGAAGAA
GAACAATAAGATATTGTATTTGATAGATACTCATCAAAACAAAATGTATATTAAAATAAA
ATAGATTCGACTACAGATAATTTGCATAATAATAGGAAATCTAAACACAGTAGATAATTA
TCTGATTAAGTATTTTCCAAAGATACAATATAACTAAAAAGTTATAATTAACAAACTCAA
AGAATCTAAAATGATGAGAATTAGAGCTTAAATAAGAAAGATATTGAAAATCAATCTTAA
TTCAAAGAACAATAATAATATGAAAGTACTGATGAGCTAAAGCAGAATAATTTTATTTCC
ATGGATTCACAAACAAAATAACACAGTTCGAGAAGCCCAAGATTTTTAAGTAACTAAAGT
AGAAATTCTAAGTCTCCATCTTCTAAATCTAATTCCCCAAACTATAATAAGTCAACTTTA
AAGACTAATTAATCTTAAGAAAATGTAAGAAAACACAGAAAATCTGTTAGATTTGAGCTT
GATCCTAAGTAATAAGGAATTAATATTCCTAAATTTGACTATTTTGATTAAAAATATAAT
GAAAATGAAGCTTTCTATTAGAAGCTGCTATCAGAAAGAAGATACAATACTACTTAGCAA
TGA


>TTHERM_00421190(protein)
MNKFQSPQSLPKKTVQFESSSQQQRSTMQKLQETANSDLNHLTASFGMTELQQGGFKNLL
KNNNNNILMQEKNQDLPRIYNNVYSPEMIIKDDINQRDESYDNIIDNYQYKQQQANQELI
QNPNELYSKSQEYNEDTLHQQQILQQQNQYILEQQQYQQQQNANSSRNKNYKGSHRQNPM
KDSKIQTYLQQMMNNTNYLKNTENSINNFTSQPSAMSAYEGSQMLQNFQSEDNEMQRNNP
PPQPESLGMVQLTYGEIAHLKQKQRQLSEEKIKASKQKKLLDEIAHFYRQLAVKKKEDQN
NRSIVTSPSPIRKSSSTSRLRKKSPQNNIIQNKQVLQQSDNRILQNSQSVISTYKAGENK
TPRQDKQSTVKQNMRYQDENHSKSVQQFQISKADTLNENQENQTDLPNQLIQAGEIQEHQ
QQDINTMMVKGNIQTKSQNQLKKSQELQYEKITQLQKNALKKPTQANNRFLNQNGSALSI
DFESQQIISLSNIFILNPVQFQALENKIKKYDISLIKQNIIQKYRFLIEKVKFSNETQNY
LSTLKDLFNEHKIMSFYDMNMLEKIQVVNKLSIKDIFSNIKETIDLTDSYETITQDIQQI
QANQNNRKHLKTTIQQEKELQTLQVLKDMQMRMAQKIFFIYLFKVQSGYKKEIIKQLDSF
EKVQNELRLTLTFNMIKYFAKIRSYKNQLQKITKQEIQLKKLKKIFDAIKQKSNKNIYYK
PFIQAIRSNRRKVLKQNSLYALFEYCQSKKSEKKQLYLSQQIYNSHLITKSYLILKAFCN
RKKNNTSIQTMTAKNISIQYILELKSVVLQAGSSFRVRQELQDYNLQDEHFEEKSHKMYQ
NRQQNILSGQNDDGEEYNNQEATIQNQFNILDNQFIDENQQFKQSENKSQIVKKQLNFQE
YDDQFCEEDVSYDSKQFQKHFYCEEEFLSSARNLLDTKRQIALDKLDKLKHLTAQSVQNE
DQSSFLQKNKEKVQEIIRENYEYSNEKPLNIQESDTKMNLVQIPPIKEEILRAENINYNK
ELKNFDQSLIDDQNILEEDCKSIVTLEQHIKQIIRVLKKLSKKKTIFQQKNPVQLLLNKD
SFFYSSGDNLSKQQMNGKQSQKNIPHPLQEHQEMIKRIEENEKKKTISFLFYHWKIVFLE
RTLNAEITLLNSLKKCKSILQIFKKKYRENNEICTLKQQIREEKIKSEIFQSWSFMASET
SQANQEKLQIFHKKLCFRRILYYSTYKKIQRVADGIHRKNLQKKILNQWDKISKSNQVVR
KKHKNALVRRYFNNWVEYISKIMFLRKFWKKILYSPDEILFEKYGNKKNLLKHILKSWRG
IVIDNENTMKQKLALKSAVNHRAVVQKTKAFFQWVNFLNIKKKLSKIFESKVIQKMFAKK
ILQPWKSAVAEQKSAISTFKRKANMNIKFKAFHCLKIKYLQNKMVENCFLKKFFYSWKVQ
QQHNQEILPRNFYSRKLVKKSFTSIIYHQLLQMKERAKTEKSTKFFLYHIKKFMQTCLLL
WQKHTQKKKSKKLLKIKLQKYSEKNIKKRAFNSLKLRKIQSRLKIIQNKKALEFKAIQYQ
KKYDLKRLITDPHLNPKLQEVLQIIHYWRAYAIKQKSIKFIQARIQKFHNRKILIEYFTS
WQNKYNQKLSLKNQAQFEEEEQQDIVFDRYSSKQNVYQNKIDSTTDNLHNNRKSKHSRQL
SDQVFSKDTIQLKSYNQQTQRIQNDENQSLNKKDIENQSQFKEQQQYESTDELKQNNFIS
MDSQTKQHSSRSPRFLSNQSRNSKSPSSKSNSPNYNKSTLKTNQSQENVRKHRKSVRFEL
DPKQQGINIPKFDYFDQKYNENEAFYQKLLSERRYNTTQQ


>TTHERM_00421190(gene)
ATGAATAAATTTTAGTCTCCTTAATCTCTTCCAAAGAAAACAGTTTAGTTTGAGTCTTCT
TCTTAGCAATAAAGAAGCACAATGTAAAAATTACAAGAAACTGCAAATTCAGATTTGAAT
CATCTCACTGCATCTTTCGGAATGACTGAACTGCAATAAGGTGGTTTTAAAAATCTTCTC
AAAAATAATAATAATAATATTTTAATGCAAGAAAAAAATCAAGACTTACCAAGGATATAC
AATAATGTTTATTCACCAGAAATGATCATTAAAGATGATATTAACCAGAGAGATGAATCA
TATGATAATATAATTGATAATTATTAGTATAAATAGTAATAAGCTAATTAAGAGTTGATC
TAAAATCCAAATGAACTCTATTCTAAATCATAGGAATATAATGAAGACACCTTACACCAA
CAATAAATACTATAGCAATAAAACTAATATATCTTAGAATAATAACAGTATCAATAATAG
TAAAATGCTAACAGCTCTAGAAATAAAAATTATAAAGGATCTCATAGGTAAAATCCTATG
AAAGACTCAAAAATTCAGACATATCTTTAGTAAATGATGAATAACACTAACTATTTAAAA
AATACTGAAAATTCTATTAATAATTTTACTTCTTAGCCAAGTGCTATGTCGGCTTATGAA
GGTTCGTAAATGTTATAAAATTTTTAATCTGAAGACAATGAAATGCAAAGAAACAATCCT
CCTCCTTAACCTGAAAGTTTGGGTATGGTTCAACTAACGTACGGCGAAATAGCTCATCTC
AAGCAAAAATAAAGATAGCTTTCTGAAGAAAAAATAAAAGCCTCAAAATAAAAAAAATTG
CTAGATGAAATAGCTCATTTTTATAGGTAATTAGCTGTTAAGAAAAAGGAGGATCAGAAT
AATAGATCAATTGTAACTTCTCCTTCTCCGATTAGAAAATCTAGTAGCACCTCTCGTTTA
AGAAAGAAATCACCATAAAATAACATTATATAAAATAAATAGGTTTTATAATAATCAGAT
AATAGGATCTTACAAAATTCTTAATCTGTAATTAGCACATATAAAGCAGGAGAAAATAAA
ACTCCAAGATAGGATAAATAGTCTACAGTCAAATAAAATATGAGATACCAAGATGAAAAT
CATTCTAAATCTGTTTAATAATTTTAAATCAGTAAAGCAGATACCTTGAATGAGAATCAA
GAAAACTAAACCGATCTACCAAATTAGTTAATTTAAGCAGGAGAGATCTAAGAACATTAA
TAATAGGATATTAACACTATGATGGTTAAAGGAAATATACAAACTAAATCTTAAAACTAA
CTTAAAAAATCTTAGGAGCTTTAATATGAAAAGATTACTTAATTACAAAAGAATGCTTTA
AAAAAACCAACTCAAGCAAATAATAGGTTTTTAAATTAAAATGGGTCAGCCTTATCAATT
GATTTTGAATCATAGTAAATTATATCTTTAAGCAATATATTTATTCTAAATCCAGTTTAA
TTCTAAGCGCTTGAAAATAAAATAAAAAAATATGATATCAGCTTGATAAAATAAAACATT
ATTTAGAAGTACAGATTTTTAATAGAAAAGGTTAAGTTTTCTAATGAAACACAAAACTAT
TTGAGTACATTAAAAGATTTGTTTAATGAACATAAGATAATGAGTTTTTATGATATGAAC
ATGTTAGAAAAAATTTAAGTTGTAAATAAATTATCTATTAAGGACATATTCTCAAATATA
AAAGAAACAATAGACCTAACTGACTCATATGAAACTATCACTCAAGATATTCAATAAATA
TAAGCTAATTAAAATAATAGAAAGCATTTAAAAACCACAATTTAATAAGAAAAAGAGCTC
TAAACATTACAGGTACTTAAAGATATGTAAATGAGAATGGCTTAAAAAATATTTTTTATA
TATCTTTTCAAAGTATAGTCTGGATACAAAAAAGAAATTATTAAATAATTAGATAGCTTT
GAAAAGGTATAAAATGAACTAAGACTTACTCTCACTTTTAACATGATTAAATACTTCGCC
AAAATTAGATCCTATAAAAATTAACTACAAAAAATTACGAAGCAAGAAATACAGCTAAAA
AAACTAAAGAAAATCTTTGATGCTATAAAATAAAAAAGCAATAAAAATATATATTATAAA
CCTTTCATCTAAGCTATCAGATCAAATAGAAGAAAAGTTTTAAAGCAAAATTCACTTTAT
GCTCTATTTGAATATTGTTAAAGCAAAAAAAGTGAAAAGAAATAACTCTATCTGAGCCAA
TAAATATACAACTCTCATTTAATTACTAAGTCTTATTTAATTTTAAAAGCTTTTTGTAAT
AGAAAAAAAAATAATACAAGCATATAAACTATGACAGCTAAAAATATTTCCATTTAGTAT
ATTCTTGAATTAAAATCTGTAGTATTGCAAGCCGGTTCTTCTTTCAGAGTAAGATAAGAA
TTGTAAGATTATAATTTATAAGATGAACATTTTGAAGAAAAATCTCATAAAATGTATCAA
AACCGACAATAGAATATTTTATCTGGACAGTAATTTATTTGTTTTGACTTATTATTTTTA
TAAAATTGAAATTTTTATTTAAAAGAAATGATGATGGAGAAGAATACAATAACCAAGAAG
CTACTATATAAAATTAATTCAATATTTTAGATAATTAATTTATTGATGAAAACTAATAAT
TCAAATAATCAGAAAATAAATCTTAAATAGTTAAGAAGTAGCTAAATTTTTAGGAATATG
ATGACCAATTTTGTGAAGAGGATGTTTCATACGATAGTAAGTAATTTTAAAAGCATTTCT
ACTGTGAAGAAGAATTCTTAAGCAGTGCAAGAAATTTGTTAGATACCAAGAGATAGATTG
CTTTAGATAAATTAGATAAGTTGAAACATTTAACAGCTTAGAGTGTATAAAATGAAGATT
AATCTTCATTTCTTTAAAAAAACAAAGAGAAAGTTTAGGAAATAATTAGAGAAAATTATG
AATATTCCAATGAAAAACCATTAAATATTTAAGAATCTGATACTAAGATGAATTTAGTTT
AAATTCCTCCAATTAAGGAAGAGATCTTAAGAGCTGAAAATATTAATTATAATAAAGAAC
TTAAAAATTTCGACTAAAGCTTAATTGATGATCAAAATATTTTAGAAGAAGATTGTAAGT
CAATAGTGACTCTTGAATAACATATTAAATAAATCATACGAGTATTAAAAAAGCTTTCAA
AAAAGAAGACAATATTCTAACAAAAAAATCCAGTTCAGCTTTTACTGAATAAAGATTCAT
TTTTCTACTCTTCAGGTGATAATTTATCCAAACAATAAATGAACGGAAAACAATCGTAAA
AGAATATACCACACCCTCTTCAAGAACATCAAGAAATGATTAAACGCATTGAAGAGAATG
AAAAAAAGAAGACAATAAGCTTTTTATTCTATCACTGGAAAATAGTCTTTTTAGAGAGAA
CTTTAAATGCAGAAATAACTCTACTAAATTCTCTCAAAAAGTGCAAATCGATTTTACAAA
TATTTAAAAAAAAATACAGAGAAAATAATGAGATTTGTACATTAAAATAATAAATAAGAG
AAGAGAAAATAAAAAGTGAAATATTTTAATCATGGTCATTTATGGCATCTGAAACTAGCT
AAGCAAATTAAGAAAAGCTCTAAATATTTCATAAAAAGTTATGTTTTAGGAGAATTCTTT
ACTACTCAACATATAAAAAGATACAGAGAGTAGCTGATGGCATCCATAGAAAAAATCTTC
AAAAGAAAATTTTAAATTAATGGGACAAAATATCTAAAAGCAATTAAGTTGTTAGAAAGA
AACACAAAAATGCTCTTGTAAGACGCTATTTCAATAACTGGGTTGAATATATTTCAAAAA
TCATGTTTTTACGTAAATTTTGGAAAAAAATACTCTACAGCCCAGATGAAATTCTTTTTG
AGAAATATGGAAATAAAAAAAATCTATTGAAACATATTTTGAAATCTTGGAGAGGTATAG
TTATAGATAATGAAAACACAATGAAGCAAAAACTTGCATTAAAATCTGCAGTTAATCACA
GGGCAGTTGTTTAAAAGACAAAAGCCTTTTTTTAGTGGGTCAATTTTCTAAACATTAAAA
AAAAGCTATCAAAGATTTTTGAAAGCAAAGTAATTTAAAAGATGTTTGCTAAAAAAATAT
TACAACCTTGGAAGAGTGCTGTAGCAGAATAAAAAAGTGCAATTTCTACATTTAAAAGGA
AAGCGAATATGAATATTAAATTTAAGGCTTTCCATTGCTTGAAAATTAAATATTTATAAA
ATAAGATGGTTGAAAACTGTTTTTTAAAGAAATTTTTCTATAGTTGGAAAGTTTAGTAAT
AACATAATTAGGAAATTCTACCCCGCAACTTTTATAGTAGAAAATTAGTAAAAAAAAGTT
TTACTTCAATTATTTACCATCAACTTCTTTAGATGAAAGAGAGAGCTAAAACAGAAAAGT
CAACTAAATTCTTTTTGTATCACATTAAAAAGTTTATGCAAACTTGCCTTCTGCTTTGGC
AAAAACACACATAAAAGAAGAAGAGTAAAAAGCTCTTGAAGATAAAACTTTAAAAGTATT
CTGAAAAAAACATTAAAAAAAGGGCATTCAATTCACTTAAACTCAGAAAGATATAATCAA
GATTAAAAATTATATAAAACAAAAAGGCTCTTGAATTTAAAGCAATTTAATACTAAAAGA
AGTATGATTTAAAAAGACTTATAACTGACCCCCACTTAAATCCAAAATTGTAAGAAGTTC
TTTAGATAATTCACTACTGGAGAGCTTATGCTATTAAATAAAAGAGTATTAAATTTATCT
AAGCAAGAATTTAAAAATTCCATAATAGAAAAATATTGATTGAATATTTTACTTCTTGGT
AAAATAAATATAATTAAAAGTTATCTTTAAAAAATTAAGCCTAATTTGAAGAAGAAGAAC
AATAAGATATTGTATTTGATAGATACTCATCAAAACAAAATGTATATTAAAATAAAATAG
ATTCGACTACAGATAATTTGCATAATAATAGGAAATCTAAACACAGTAGATAATTATCTG
ATTAAGTATTTTCCAAAGATACAATATAACTAAAAAGTTATAATTAACAAACTCAAAGAA
TCTAAAATGATGAGAATTAGAGCTTAAATAAGAAAGATATTGAAAATCAATCTTAATTCA
AAGAACAATAATAATATGAAAGTACTGATGAGCTAAAGCAGAATAATTTTATTTCCATGG
ATTCACAAACAAAATAACACAGTTCGAGAAGCCCAAGATTTTTAAGTAACTAAAGTAGAA
ATTCTAAGTCTCCATCTTCTAAATCTAATTCCCCAAACTATAATAAGTCAACTTTAAAGA
CTAATTAATCTTAAGAAAATGTAAGAAAACACAGAAAATCTGTTAGATTTGAGCTTGATC
CTAAGTAATAAGGAATTAATATTCCTAAATTTGACTATTTTGATTAAAAATATAATGAAA
ATGAAGCTTTCTATTAGAAGCTGCTATCAGAAAGAAGATACAATACTACTTAGCAATGA