Identifiers and Description

Gene Model Identifier

TTHERM_00392670

Standard Name

SFR10 (Sfi1 repeat protein)

Aliases

PreTt23495 | 42.m00229 | 3813.m01452

Description

cortical row basal body localization; predicted to have 15 sfi1 repeats; Leucine Rich Repeat family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00392670

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11474.19.997093137033517e-262leucine rich repeat family pro
tein (1784 aa)
OxytrichaContig4888.0.g904.997543945741262e-17Leucine Rich repeats (2 copies
)
WormBaseWBGene000033900.0000029996948234116693locus:mog-2 Probable U2 smal
l nuclear ribonucleoprotein A
status:Confirmed UniProt:Q
9BLB6 protein_id:CCD61684.1
SGDYPL213W0.0007003012208360162LEA1 Component of U2 snRNP; di
sruption causes reduced U2 snR
NP levels; physically interact
s with Msl1p; putative homolog
of human U2A snRNP protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00392670(coding)
ATGAATTCCTATTAGTATGTGAATAAGCTAAAGAAGCAAATCAAATAAACTTCTACACAA
GGATGGAAGCAAAGAGTTAATTAGAAGACATCATATATAAATTAGATTCCACTCTCGAAT
GCATTAGAGAGATTTCCTCAGTTCTTTGATGATATAAAGATTTCAGTAGTGTAGAAGAGC
ATTAATGAGATAGATCGTTTACCTTACAAATATAATAATATTGAAATTCTTTACCTTAGC
AACAATAATTTAACTGACTTAGAAGGTATCCAGCAATTCAAAAAGTTAAAAACATTAACT
TTAGCCCATAATGAGCTTTCAAATGTGAAAATTCTCAGGTAGATATCTTAACTAAATTCT
CTAGAGTAATTAAATTTATCTGGAAATCCCATAGCAAAGCATCCAAATTACAAGATTTAC
TTATTGACTGTTCTACCAAATTTAAAAAGCCTTGATGGAAGACCCGTCAGCGAGGAGGCA
AGATTAAAAGCGGAAATAAAAGCAAAATAGCAAACCCAACTTCTGCAGTTGATGTTGAAG
AATTATTGCGAAATAATTAAACTAAATTCATTTGGGAGAAAGATTGATCTGCACAGAGAA
ATGATATAAAATAATTTAAAATTTGTAAAAAATATGGAAAATAAGGAATTGAATCATTAT
TCCTTCAAAAACAAATTTGATTTTATGCAGACTCTCGATGAATATAATAAGAACGAGCTA
TAAGACTTGCTATTGAATGATATTCTCACCTTCTATGAATAGTTTTAATAACAAAACCCA
AATAACAATGAGGAAGATAACTACGATAAGGCTTTCTAAGAAATGATCAAACAATAAAAT
ATCAAATTAGCTGAGATAGATGTTCTCCTTGAAAAAAAAGTTTAAAATTATAATGAATTT
TTAGAAGAAATGATAGCTAAATTTAAACCTCTGCCTCAAAATGTAAAAACATTTTCTCCA
TCTAGAAACTTGGCATCTTCTGATGCTTAAAACAAGACCAGTAGCAGACTAAATTTCAAA
ACTAGCGAGAATAAAGCGAAGTAGATTCTTAAAAATAGCAAATCAAACTAGAGTCTACCC
ACATCGGATAAAGCAGGTGCTCTGTAGTCTCTAAATAAAAAAAAGTTATCTAGAGATTTT
AAATAAAATAATATTCCTGATGAAGAGAGAGATTTATTCTAAAAGATAAATCAAGGAAAT
TCAAACACAAATGAAAGCTTCAATCCTGTTTCGCCTATCACTGACAATTAAATTTTCAGT
ACTTCGAAAGATAAATTATTTTTTACTTCAAATACTTAGCAAGATCAAATTCATTACACT
TAGCTATAAGAAGAATAAGATATTTTGTTAGGGAAATAATAAAAAAACTAAAAAAATGAA
CAAACTTAGCAATAGAGATTCAACACTTATTAAAGTTAATAGCCAACAAATTAAAATAAT
TTACAAAGAAATTTATCAGCTGAGAATATATTGTACCAGAGAAGTGGGTCTCCTAGTGAT
TACGTTATCAAGGATAGATACTATTCTCCAACCAATAATGAATAAGTCAGCAGAAGAAAC
TAAGGTGGTTACGATTCTTCTCTTGAGAATACTTCCCGTGGAGTGGCAAACAATTAATAA
TAATAAGAATCTAAAGAAAACTCCCCAAATAGAACTATTCCTCAACCATCTTAATATGAA
ATAAGACCAAATCATCAGGATGAATGCTGCAGAAAACTCATGAAATCAGCTAGAAATACT
TCACAAGATTTCTTTGGCAAGCCCACACCTTATAAGAGAAGAAATAAAGAGCTCGAAGAA
ATTGTTTTTGAACTAAATAAAAAGCTGTAAAAAAAGGAAGATGATATTGCTTAATTAAAA
TAATTAAATGGCACTATTAAAGAAAAACTTGTTGAGGTCAACAGCAGCAGTGAAAATAAT
TTGAAAAAGTAGTAGCAAGACTAACTAGAATTAATGAAATAGCTGGAGAAAAATTAAAAT
TTAAACAAAGTCTTAGACCATGAAGTGAAGGAATTGAGAGATCAATTGAACAGGATGTTA
ATTAAAAATAATGAACTTAGCAATGCTGAAAAGAATAGCATTTATTACAAGTAATAGCAA
TAAGACATTTAAGAATAATATGATATACTTTAGTCAGAACTTAAAAAAAAAGAAATTGCA
GATAATTTCTGTCAGTAAAGAATATTAAAATTAGGTTTCCTTTACCTTAAGTTTTCTACT
CAAACAGAGAAAAAGATAAATGAGTTTAGATATGACAAGAAAAATGAAAGAAATCAATTT
TTAATTGTCAACTGCTTTAAAAAAATGAAACGCTATTCTGTCATTAAAAAGTTTAGTCGT
GTCTCTTTACAAGAATAGAATCTTACTTTATATCATAATTACTTCAATTCTTGGAAGCGT
AATATTATTTTTTAAAGCGATGTACAGAGAATGCTAAAGAAGAAGGAGCAATAAAATTTG
GCATAAGCATTCGTTGGATGGAAGTAATTTATTGCTATAAAAGAAAGAAATTTAAAAGAA
AAGGCAAAAGTTAAAGAATTTTACTTAAAGCAGCTCCAGATTAAGATTTGGAGAGCGATG
AAATAACAATACAAAAAGAGCGTTCTTTCTAAAAAAGAACTAGATTTATATCAATAAAAG
GCCACAATATTTGATAATAGCAAAACTAAGAGAAGGTTTTTGAAACTTTGGAAGTCATAC
ATTGTTAATTTTGCTTTACCATATAAATAGAAATAATAAAATGCTATTAGATAATCTAAC
TTTTATCTATTAAAAGTGGGCTTTGCTATGCTCGTTAAAAATCGCAAAGATTCTATCAAC
AATAATATAAAAGTTAACAAATTTATTCATTATAAAAAGAAGCAGCTACTTCGCTCTGTC
TTTAATTATATGTCAGGTCCTTTGGTTGCTTTCTCAAGAGAAAAGAATGCTAGAAATAAA
GTGGCTGAATTATTCATCAAAAAAAGACTTATTAATACCTGGAAGTAAACCTATTGTATT
TCTAGAAATTTAAAGAGACTGGAAGAAAAGGCAAAGCAATTTAGTTTGAAAAAATTAGTT
TAAAGACATTTTAATGCCTTGAAGGACTTAAGAGAGAAGGTAAGAAAGAGAAATTTATTA
GCAAAGGCTGTGCAAACAAGAAGAGAAAATTAATAGAAGAGAATTTCAATTTTGAAGTGG
TTTAAATTATCAGTATCTAAAAAATCAGATAGATTAGATTAACTCAAGCAAAAGAATGAT
TTATAGAGAGCTTATTTCAAGTAGTGGCTTCTGCTTATTTAGTAAAGAGTTTAGAAAAAA
TAGAAATAAAGATAGATTCTGAATATGGCTGACAAAAAATCAAAACTGACTCTGTCTTAG
GCATTCAACTCCTGGCTTTATATAATCAAGAGAAAAATTAGAAATAGAGGAGTTGTACAA
AATATGTTAGCTAAAAAAGAAACTTAGTTGCTAAGAATATCTTTGTTCTAATTTTCTAAA
GAATAAAAACTAGGTTTGTATAAGAAATTATTGCAGTACAAAAATAACCAAACATTGCTC
AATGCAGATTTCAAAGAAAATCAAATAGTTTTAGAAACAATAAACGAAGAAAAAAATGAA
ATAGTTGATAAATCCCGTGAACTCATGCAATAAAATGTACTGCTTCAAGAACACATCACA
GAAAAGAATTCAGAAATTAATCAGCTGAAGAGATAGATTTAAAACTTAGAAAAGTTAGAA
GCTAACCAAGAAGAAGTGATAAAAGACTTGTAACAAAAAATAGGCGAACAGGAAATGTAA
ATTTTTGAAATCAATAACGAGTATACAGTCTAAATGGATTAAGAAGAAAACACCTAAAAG
ACTATGAGAATGGATAATAAAGCTATGCAAAGAGAAATCCAAAATCTTCAAAAGGAATTA
GACTTAAAGAACACTTAACTTGCAGAGTATGAAAGGTCTTTTTAAAATAGAACCACAGAA
TTGTTTGGTGATAATAGAGATCTTTAGGAGAAATTATAGAACTCTATTGTAATGGCTAAT
GAATTCAAGCAAAAGATAGAATAACAAGATAGCATTATTGCTAACCTAGAAAACAAAATC
ATAGAGTTGAATGATAATAATTAAAAATAAAAGGAGCATATCACTGAGTGTGTGGGTGTT
ATTCAATAATTTGAAAGCACTTATGATGCTAAAGTGACTGAATACGAAAATATAATTAAT
TTACTGAATACTTAGTTAGATGAGAACAAAGTATAATAGGAACAGTCAAATGCCATAATT
GAGTAACTTACTTAGGAAGTAAAAAAATTAGAATACGAAGTATCACTTTTGACTGAAGAT
CATCATGCTAATACAAACCAATTTATAAGTAGTCTTTATAAGAGTGGATAAAAGTAGATG
TTCTCTTCAATAGGATTCAATTAAAATTTAAACCATTCGATTTCTTCAGAAGCTGATGCA
TTTACTCTTAGAAAAAGACAAAATTATTTCACTTCTCCTCTCCAAACTGATCAGAATAGA
AGAACGGCTTCTAAAGATTATAAGATATTATAAAAATCATTTGAGAGATAAAGGACTCAA
ATGAAAGACAAAATCTAATCTCTTACTTAGCAAATTCAAAACACATTAAATAGTTAAGGT
TAAGAAGAATTACTTCCCTAGTAAGATATTAATATAAACAATAGAATGAATGGTGCCTAA
TATAATTTTGTCAGTAACGGCTTCCAATCAGCTAAATCAAACCAATCTTAGATTCTTCTT
TCTGCCAAGCCATAAAACAAAACTTCAACTGCTAATTTTTTCACAGATAGAAGATAATTA
AACTAGGATAAATCTTATGAAGACTCATCTAAATTTATAAATTTGAAAGGTTCAGGCTTG
TATAGTAATAATTTATTAAAGAACAATGAGAGAAAAGAAAGCCCTATTAACAGCTTAAAA
GTGACTCCAAAGGTTTATAAATATAAAAATAGCAGCATTAGTGGAGGTCTAGGAATAGGA
ATAAATTTAATGCCAAACTTCACTGCTTTGGGATAATCTTAGAGCACTACTCATGCAATA
AAAAATGATCTCCATTCTATTGTATCTCCTTCTTACAACCTTAGTTCTAATATATAAAAT
TTAAGGCCAGACTCTGCTAAAGAAAGTCGTACTTAAAAATCAAGTGTTAACGATCTCTCT
ATGATAAATAATACTGAAAATATTCTTTAAGAGTTAGAAAAAAGTAAATCAGGAAGAAAG
ATAATAAAAAATTAATTGGAATTAAGAATTAAGAATCTTAATGACAACTTAGAATAGGAC
ATTTAAAACGCAAAAAGATTGAATGCAGCAAGAGACAACTAATGA


>TTHERM_00392670(protein)
MNSYQYVNKLKKQIKQTSTQGWKQRVNQKTSYINQIPLSNALERFPQFFDDIKISVVQKS
INEIDRLPYKYNNIEILYLSNNNLTDLEGIQQFKKLKTLTLAHNELSNVKILRQISQLNS
LEQLNLSGNPIAKHPNYKIYLLTVLPNLKSLDGRPVSEEARLKAEIKAKQQTQLLQLMLK
NYCEIIKLNSFGRKIDLHREMIQNNLKFVKNMENKELNHYSFKNKFDFMQTLDEYNKNEL
QDLLLNDILTFYEQFQQQNPNNNEEDNYDKAFQEMIKQQNIKLAEIDVLLEKKVQNYNEF
LEEMIAKFKPLPQNVKTFSPSRNLASSDAQNKTSSRLNFKTSENKAKQILKNSKSNQSLP
TSDKAGALQSLNKKKLSRDFKQNNIPDEERDLFQKINQGNSNTNESFNPVSPITDNQIFS
TSKDKLFFTSNTQQDQIHYTQLQEEQDILLGKQQKNQKNEQTQQQRFNTYQSQQPTNQNN
LQRNLSAENILYQRSGSPSDYVIKDRYYSPTNNEQVSRRNQGGYDSSLENTSRGVANNQQ
QQESKENSPNRTIPQPSQYEIRPNHQDECCRKLMKSARNTSQDFFGKPTPYKRRNKELEE
IVFELNKKLQKKEDDIAQLKQLNGTIKEKLVEVNSSSENNLKKQQQDQLELMKQLEKNQN
LNKVLDHEVKELRDQLNRMLIKNNELSNAEKNSIYYKQQQQDIQEQYDILQSELKKKEIA
DNFCQQRILKLGFLYLKFSTQTEKKINEFRYDKKNERNQFLIVNCFKKMKRYSVIKKFSR
VSLQEQNLTLYHNYFNSWKRNIIFQSDVQRMLKKKEQQNLAQAFVGWKQFIAIKERNLKE
KAKVKEFYLKQLQIKIWRAMKQQYKKSVLSKKELDLYQQKATIFDNSKTKRRFLKLWKSY
IVNFALPYKQKQQNAIRQSNFYLLKVGFAMLVKNRKDSINNNIKVNKFIHYKKKQLLRSV
FNYMSGPLVAFSREKNARNKVAELFIKKRLINTWKQTYCISRNLKRLEEKAKQFSLKKLV
QRHFNALKDLREKVRKRNLLAKAVQTRRENQQKRISILKWFKLSVSKKSDRLDQLKQKND
LQRAYFKQWLLLIQQRVQKKQKQRQILNMADKKSKLTLSQAFNSWLYIIKRKIRNRGVVQ
NMLAKKETQLLRISLFQFSKEQKLGLYKKLLQYKNNQTLLNADFKENQIVLETINEEKNE
IVDKSRELMQQNVLLQEHITEKNSEINQLKRQIQNLEKLEANQEEVIKDLQQKIGEQEMQ
IFEINNEYTVQMDQEENTQKTMRMDNKAMQREIQNLQKELDLKNTQLAEYERSFQNRTTE
LFGDNRDLQEKLQNSIVMANEFKQKIEQQDSIIANLENKIIELNDNNQKQKEHITECVGV
IQQFESTYDAKVTEYENIINLLNTQLDENKVQQEQSNAIIEQLTQEVKKLEYEVSLLTED
HHANTNQFISSLYKSGQKQMFSSIGFNQNLNHSISSEADAFTLRKRQNYFTSPLQTDQNR
RTASKDYKILQKSFERQRTQMKDKIQSLTQQIQNTLNSQGQEELLPQQDININNRMNGAQ
YNFVSNGFQSAKSNQSQILLSAKPQNKTSTANFFTDRRQLNQDKSYEDSSKFINLKGSGL
YSNNLLKNNERKESPINSLKVTPKVYKYKNSSISGGLGIGINLMPNFTALGQSQSTTHAI
KNDLHSIVSPSYNLSSNIQNLRPDSAKESRTQKSSVNDLSMINNTENILQELEKSKSGRK
IIKNQLELRIKNLNDNLEQDIQNAKRLNAARDNQ


>TTHERM_00392670(gene)
ATGAATTCCTATTAGTATGTGAATAAGCTAAAGAAGGTAAAAAATCCAAATTTCATTACA
ATTTATACATACATATTCTCAAAATTTATTATGATCATCAAAACATTAAAATTGTCTTGT
TAATTGAAAAGCAAATCAAATAAACTTCTACACAAGGATGGAAGCAAAGAGTTAATTAGA
AGACATCATATATAAATTAGATTCCAGTATATTTAATTTACATTTTCAAAGAGATAACAA
ATAAATATGCATTATTTATAAAATTTTCAATAGCTCTCGAATGCATTAGAGAGATTTCCT
CAGTTCTTTGATGATATAAAGATTTCAGTAGTGTAGAAGAGCATTAATGAGATAGATCGT
TTACCTTACAAATATAATAATATTGAAATTCTTTACCTTAGCAACAATAATTTAACTGAC
TTAGAAGGTATCCAGCAATTCAAAAAGTTAAAAACATTAACTTTAGCCCATAATGAGGTA
AATAAGTTACTAATTTCATTTCAATCATAGGATTTTTATAGCAACAAATATAAAAAAATA
TCAGAAAAAAAGGTTTTTTGTTTAATAAAAAGCTTTCAAATGTGAAAATTCTCAGGTAGA
TATCTTAACTAAATTCTCTAGAGTAATTAAATTTATCTGGAAATCCCATAGCAAAGCATC
CAAATTACAAGATTTACTTATTGACTGTTCTACCAAATTTAAAAAGCCTTGATGGAAGAG
TAAGATAAAATAGTTAGGATCTCTAAAGATCGAACTTACTTAATTAATTTTGATATGTTC
ATGAAATTATTTTAATATAAATAGCCCGTCAGCGAGGAGGCAAGATTAAAAGCGGAAATA
AAAGCAAAATAGCAAACCCAACTTCTGCAGTTGATGTTGAAGAATTATTGCGAAATAATT
AAACTAAATTCAGTAAATTTTTAAAAATAAATTTTATTGCAATAATTAAATCGAATGATT
TTTTGTAATTAATACTAAATCAATAAATCTAGTTTGGGAGAAAGATTGATCTGCACAGAG
AAATGATATAAAATAATTTAAAATTTGTAAAAAATATGGAAAATAAGGAATTGAATCATT
ATTCCTTCAAAAACAAATTTGATTTTATGCAGACTCTCGATGAATATAATAAGAACGAGC
TATAAGACTTGCTATTGAATGATATTCTCACCTTCTATGAATAGTTTTAATAACAAAACC
CAAATAACAATGAGGAAGATAACTACGATAAGGCTTTCTAAGAAATGATCAAACAATAAA
ATATCAAATTAGCTGAGATAGATGTTCTCCTTGAAAAAAAAGTTTAAAATTATAATGAAT
TTTTAGAAGAAATGATAGCTAAATTTAAACCTCTGCCTCAAAATGTATTTTGATTCATTT
TAAAATTATTTTTTTATTTTTTACTTTTGTTAGGTAAAAACATTTTCTCCATCTAGAAAC
TTGGCATCTTCTGATGCTTAAAACAAGACCAGTAGCAGACTAAATTTCAAAACTAGCGAG
AATAAAGCGAAGTAGATTCTTAAAAATAGCAAATCAAACTAGAGTCTACCCACATCGGAT
AAAGCAGGTGCTCTGTAGTCTCTAAATAAAAAAAAGTTATCTAGAGATTTTAAATAAAAT
AATATTCCTGATGAAGAGAGAGATTTATTCTAAAAGATAAATCAAGGAAATTCAAACACA
AATGAAAGCTTCAATCCTGTTTCGCCTATCACTGACAATTAAATTTTCAGTACTTCGAAA
GATAAATTATTTTTTACTTCAAATACTTAGCAAGATCAAATTCATTACACTTAGCTATAA
GAAGAATAAGATATTTTGTTAGGGAAATAATAAAAAAACTAAAAAAATGAACAAACTTAG
CAATAGAGATTCAACACTTATTAAAGTTAATAGCCAACAAATTAAAATAATTTACAAAGA
AATTTATCAGCTGAGAATATATTGTACCAGAGAAGTGGGTCTCCTAGTGATTACGTTATC
AAGGATAGATACTATTCTCCAACCAATAATGAATAAGTCAGCAGAAGAAACTAAGGTGGT
TACGATTCTTCTCTTGAGAATACTTCCCGTGGAGTGGCAAACAATTAATAATAATAAGAA
TCTAAAGAAAACTCCCCAAATAGAACTATTCCTCAACCATCTTAATATGTAAAAATATTT
ATTTATATTTAATTAAATTTTATGAAAATTTATTGAAATTAAAGGAAATAAGACCAAATC
ATCAGGATGAATGCTGCAGAAAACTCATGAAATCAGCTAGAAATACTTCACAAGATTTCT
TTGGCAAGCCCACACCTTATAAGAGAAGAAATAAAGAGCTCGAAGAAATTGTTTTTGAAC
TAAATAAAAAGCTGTAAAAAAAGGAAGATGATATTGCTTAATTAAAATAATTAAATGGCA
CTATTAAAGAAAAACTTGTTGAGGTCAACAGCAGCAGTGAAAATAATTTGAAAAAGTAGT
AGCAAGACTAACTAGAATTAATGAAATAGCTGGAGAAAAATTAAAATTTAAACAAAGTCT
TAGACCATGAAGTGAAGGAATTGAGAGATCAATTGAACAGGATGTTAATTAAAAATAATG
AACTTAGCAATGCTGAAAAGAATAGCATTTATTACAAGTAATAGCAATAAGACATTTAAG
AATAATATGATATACTTTAGTCAGAACTTAAAAAAAAAGAAATTGCAGATAATTTCTGTC
AGTAAAGAATATTAAAATTAGGTTTCCTTTACCTTAAGTTTTCTACTCAAACAGAGAAAA
AGATAAATGAGTTTAGATATGACAAGAAAAATGAAAGAAATCAATTTTTAATTGTCAACT
GCTTTAAAAAAATGAAACGCTATTCTGTCATTAAAAAGTTTAGTCGTGTCTCTTTACAAG
AATAGAATCTTACTTTATATCATAATTACTTCAATTCTTGGAAGCGTAATATTATTTTTT
AAAGCGATGTACAGAGAATGCTAAAGAAGAAGGAGCAATAAAATTTGGCATAAGCATTCG
TTGGATGGAAGTAATTTATTGCTATAAAAGAAAGAAATTTAAAAGAAAAGGCAAAAGTTA
AAGAATTTTACTTAAAGCAGCTCCAGATTAAGATTTGGAGAGCGATGAAATAACAATACA
AAAAGAGCGTTCTTTCTAAAAAAGAACTAGATTTATATCAATAAAAGGCCACAATATTTG
ATAATAGCAAAACTAAGAGAAGGTTTTTGAAACTTTGGAAGTCATACATTGTTAATTTTG
CTTTACCATATAAATAGAAATAATAAAATGCTATTAGATAATCTAACTTTTATCTATTAA
AAGTGGGCTTTGCTATGCTCGTTAAAAATCGCAAAGATTCTATCAACAATAATATAAAAG
TTAACAAATTTATTCATTATAAAAAGAAGCAGCTACTTCGCTCTGTCTTTAATTATATGT
CAGGTCCTTTGGTTGCTTTCTCAAGAGAAAAGAATGCTAGAAATAAAGTGGCTGAATTAT
TCATCAAAAAAAGACTTATTAATACCTGGAAGTAAACCTATTGTATTTCTAGGTAATTAT
CAATCATATTTAATAAATTTAATTAAAATTGTAAAATACTTTCATAATTAATTGTTTGGT
TTTTAAGCTTATATCAAAGTTAATAATAAATATTTTTTAATAGAAATTTAAAGAGACTGG
AAGAAAAGGCAAAGCAATTTAGTTTGAAAAAATTAGTTTAAAGACATTTTAATGCCTTGA
AGGACTTAAGAGAGAAGGTAAGAAAGAGAAATTTATTAGCAAAGGCTGTGCAAACAAGAA
GAGAAAATTAATAGAAGAGAATTTCAATTTTGAAGTGGTTTAAATTATCAGTATCTAAAA
AATCAGATAGATTAGATTAACTCAAGCAAAAGAATGATTTATAGAGAGCTTATTTCAAGT
AGTGGCTTCTGCTTATTTAGTAAAGAGTTTAGAAAAAATAGAAATAAAGATAGATTCTGA
ATATGGCTGACAAAAAATCAAAACTGACTCTGTCTTAGGCATTCAACTCCTGGCTTTATA
TAATCAAGAGAAAAATTAGAAATAGAGGAGTTGTACAAAATATGTTAGCTAAAAAAGAAA
CTTAGTTGCTAAGAATATCTTTGTTCTAATTTTCTAAAGAATAAAAACTAGGTTTGTATA
AGAAATTATTGCAGTACAAAAATAACCAAACATTGCTCAATGCAGATTTCAAAGAAAATC
AAATAGTTTTAGAAACAATAAACGAAGAAAAAAATGAAATAGTTGATAAATCCCGTGAAC
TCATGCAATAAAATGTACTGCTTCAAGAACACATCACAGAAAAGAATTCAGAAATTGTAA
TTTATTATTTTTGTGAATCTAAAAATAAAACTTTTATGACTAAAAATATAGAATCAGCTG
AAGAGATAGATTTAAAACTTAGAAAAGTTAGAAGCTAACCAAGAAGAAGTGATAAAAGAC
TTGTAACAAAAAATAGGCGAACAGGAAATGTAAATTTTTGAAATCAATAACGAGTATACA
GTCTAAATGGATTAAGAAGAAAACACCTAAAAGACTATGAGAATGGATAATAAAGCTATG
CAAAGAGAAATCCAAAATCTTCAAAAGGAATTAGACTGTAAAAATTCCTCATAATTTATT
CAATAAAATTTATTTAAGCTTTTTTAAATTTCAACAAAAAACTTTTAAGTGAAAAATTAT
TTAATTATTAAAATTGTTAAATAATAAAAAAATCTTTTGTTTGATTAAAATTAAATTATT
ACCAAAAAAATATTTAATTTTTCAAAAATTATTTGTAAATTTAGCTTACTGAAATTATGT
TACTAAATAATTTGTTTGTTTATTTGTTTAAATAAATATTTATTTTTTAATAAAAATATT
TTTAATGCTTATATTAGTAAAGAACACTTAACTTGCAGAGTATGAAAGGTCTTTTTAAAA
TAGAACCACAGAATTGTTTGGTGATAATAGAGATCTTTAGGAGAAATTATAGAACTCTAT
TGTAATGGCTAATGAATTCAAGCAAAAGATAGAATAACAAGATAGCATTATTGCTAACCT
AGAAAACAAAATCATAGAGTTGAATGATAATAATTAAAAATAAAAGGAGCATATCACTGA
GTGTGTGGGTGTTATTCAATAATTTGAAAGCACTTATGATGCTAAAGTGACTGAATACGA
AAATATAATTAATTTACTGAATACTTAGTTAGATGAGAACAAAGTATAATAGGAACAGTC
AAATGCCATAATTGAGTAACTTACTTAGGAAGTAAAAAAATTAGAATACGAAGTATCACT
TTTGACTGAAGATCATCATGCTAATACAAACCAATTTATAAGTAGTCTTTATAAGAGTGG
ATAAAAGTAGATGTTCTCTTCAATAGGATTCAATTAAAATTTAAACCATTCGATTTCTTC
AGAAGCTGATGCATTTACTCTTAGAAAAAGACAAAATTATTTCACTTCTCCTCTCCAAAC
TGATCAGAATAGAAGAACGGCTTCTAAAGATTATAAGATATTATAAAAATCATTTGAGAG
ATAAAGGACTCAAATGAAAGACAAAATCTAATCTCTTACTTAGCAAATTCAAAACACATT
AAATAGTTAAGGTTAAGAAGAATTACTTCCCTAGTAAGATATTAATATAAACAATAGAAT
GAATGGTGCCTAATATAATTTTGTCAGTAACGGCTTCCAATCAGCTAAATCAAACCAATC
TTAGATTCTTCTTTCTGCCAAGCCATAAAACAAAACTTCAACTGCTAATTTTTTCACAGA
TAGAAGATAATTAAACTAGGATAAATCTTATGAAGACTCATCTAAATTTATAAGTAAATT
TTAAATTAATTAAAAAAAATAAAGCTAATTACTTTTATTAAGATTTGAAAGGTTCAGGCT
TGTATAGTAATAATTTATTAAAGAACAATGAGAGAAAAGAAAGCCCTATTAACAGCTTAA
AAGTGACTCCAAAGGTTTATAAATATAAAAATAGCAGCATTAGTGGAGGTCTAGGAATAG
GAATAAATTTAATGCCAAACTTCACTGCTTTGGGATAATCTTAGAGCACTACTCATGCAA
TAAAAAATGATCTCCATTCTATTGTATCTCCTTCTTACAACCTTAGTTCTAATATATAAA
ATTTAAGGCCAGACTCTGCTAAAGAAAGTCGTACTTAAAAATCAAGTGTTAACGATCTCT
CTATGATAAATAATACTGAAAATATTCTTTAAGAGTAATTTTTTTTTTAGAAATCCAAAT
AATTGAAAGTATTTTATAAAATGTAATAATTAGGTTAGAAAAAAGTAAATCAGGAAGAAA
GATAATAAAAAATTAATTGGAATTAAGAATTAAGAATCTTAATGACAACTTAGAATAGGA
CATTTAAAACGCAAAAAGATTGAATGCAGCAAGAGACAACTAATGA