Identifiers and Description

Gene Model Identifier

TTHERM_00463380

Standard Name

SFR1 (SFi1 Repeat 1)

Aliases

PreTt25790 | 54.m00246 | 3823.m01157

Description

Sfi1 repeat containing protein; localized to basal bodies

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00463380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10719.15.998305401373361e-129hypothetical protein (213 aa)

General Information

Paragraph NoGene NameParagraph Text
47SFR1The gene model is incorrect. The cDNA sequence, as determined by RT-PCR, is: ATGAGTTTAGTTTAGAGAACAATATAGGCTTATGAGAAGGATGAAAACAAAAACTTCGAAGAGTTCATTGAAAAAAGTTTAAAAGCATTTAGAGAAGAAGGTATGAAATTCGAGTAGTAAAAGGAGTGCAATTCGTAATAAATGTCTGATAACTAAAGAAACGAATGGGAAGAAAAAATAGCTAGTTTGGAAAGTCTTTTTAAAATGTTTTGTGTGCTTAAAGGTTAAAAGAGAAAGAAATCAAGAGTCATGTATAACATTTGTGAGCATATTTATGGAAAGAATTTACTAAAAAGAACATTTTGGTGCTGGAAAAGCCACCAGAAGAATGAAGAATATCTGCGTTAGATGGAAGAGTAAGCAGATGTATTTTATAACAGAAGGACACTAACAAAAATAATGAGAAGTTGGTAAGATGTTGTAATTGATGAGAATAAAACAATAGTTAAAAACACTGCCTTAAAGAAAACTGAGTTAGAATTGCAAAAAAATCAAAAGGAGTTTGAAAACCAAATTAAGAGTTTGGAAATTTTGCTATAATAAAAAATATTAACACTGAGACATGAAGAATAACAATACAACATTTTATTCTAAAAATAATAGCTCCTTTCATAAAATTAAAAAATTGAATTTGATTGA The corresponding protein sequence is: MSLVQRTIQAYEKDENKNFEEFIEKSLKAFREEGMKFEQQKECNSQQMSDNQRNEWEEKIASLESLFKMFCVLKGQKRKKSRVMYNICEHIYGKNLLKRTFWCWKSHQKNEEYLRQMEEQADVFYNRRTLTKIMRSWQDVVIDENKTIVKNTALKKTELELQKNQKEFENQIKSLEILLQQKILTLRHEEQQYNILFQKQQLLSQNQKIEFD

Associated Literature

  1. Ref:27904881: Heydeck W, Stemm-Wolf AJ, Knop J, Poh CC, Winey M (2016) Sfr1, a Tetrahymena thermophila Sfi1 Repeat Protein, Modulates the Production of Cortical Row Basal Bodies. mSphere 1(6):

Sequences

>TTHERM_00463380(coding)
ATGAGTTTAGTTTAGAGAACAATATAGGCTTATGAGAAGGATGAAAACAAAAACTTCGAA
GAGTTCATTGAAAAAAGTTTAAAAGCATTTAGAGAAGAAGGTATGAAATTCGAGTAGTAA
AAGGAGTGCAATTCGTAATAAATGTCTGATAACTAAAGAAACGAATGGGAAGAAAAAATA
GCTAGTTTGGAAAGTCTTTTTAAAATGTTTTGTGTGCTTAAAGGTTAAAAGAGAAAGAAA
TCAAGAGTCATGTATAACATTTGTGAGCATATTTATGGAAAGAATTTACTAAAAAGAACA
TTTTGGTGCTGGAAAAGCCACCAGAAGAATGAAGAATATCTGCGTTAGATGGAAGAGTAA
GCAGATGTATTTTATAACAGAAGGACACTAACAAAAATAATGAGAAGTTGGTAAGATGTT
GTAATTGATGAGAATAAAACAATAGTTAAAAACACTGCCTTAAAGAAAACTGAGTTAGAA
TTGCAAAAAAATCAAAAGGAGTTTGAAAACCAAATTAAGAGTTTGGAAATTTTGCTATAA
TAAAAAATATTAACACTGAGACATGAAGAATAACAATACAACATTTTATTCTAAAAATAA
TAGCTCCTTTCATAAAATTAAAAAATTGAATTTGATTGA


>TTHERM_00463380(protein)
MSLVQRTIQAYEKDENKNFEEFIEKSLKAFREEGMKFEQQKECNSQQMSDNQRNEWEEKI
ASLESLFKMFCVLKGQKRKKSRVMYNICEHIYGKNLLKRTFWCWKSHQKNEEYLRQMEEQ
ADVFYNRRTLTKIMRSWQDVVIDENKTIVKNTALKKTELELQKNQKEFENQIKSLEILLQ
QKILTLRHEEQQYNILFQKQQLLSQNQKIEFD


>TTHERM_00463380(gene)
TTAAATAAAATCAAATCACAAATTCAAAAAATACAAAATTTAGAGTTTGATTAATATTTT
GTAAACATAGAATCATTATCAATAAACAAACAATAAATAGTTAGTTAGATAGATAGATTG
ATCGAGAGATAATAAAATAAACCAAAAATATTTGACTTGGAGGAGAAAATGAGTTTAGTT
TAGAGAACAATATAGGCTTATGAGAAGGATGAAAAGTAGAGCTCATTATTTTGTTTGTTT
ATTTTCTTTATGCTCTTATGTATTCTTATTCAGTGATTAAGCAAATTTTATTTAAATTAA
TAGCAAAAACTTCGAAGAGTTCATTGAAAAAAGTTTAAAAGCATTTAGAGAAGAAGGTAT
GAAATTCGAGTAGTAAAAGGAGTGCAATTCGTAATAAATGTCTGATAACTAAAGAAACGA
ATGGGAAGAAAAAATAGCTAGTTTGGAAAGTCTTTTTAAAATGTTTTGTGTGCTTAAAGG
TTAAAAGAGAAAGAAATCAAGAGTCATGTATAACATTTGTGAGCATATTTATGGAAAGAA
TTTACTAAAAAGAACATTTTGGTGCTGGAAAAGCCACCAGAAGAATGAAGAATATCTGCG
TTAGATGGAAGAGTAAGCAGATGTATTTTATAACAGAAGGACACTAACAAAAATAATGAG
AAGTTGGTAAGATGTTGTAATTGATGAGAATAAAACAATAGTTAAAAACACTGCCTTAAA
GAAAACTGAGTTAGAATTGCAAAAAAATCAAAAGGAGTTTGAAAACCAAATTAAGAGTTT
GGAAATTTTGCTATAATAAAAAATATTAACACTGAGACATGAAGAATAACAATACAACAT
TTTATTCTAAAAATAATAGCTCCTTTCATAAAATTAAAAAATTGAATTTGATTGA