Identifiers and Description

Gene Model Identifier

TTHERM_00463380

Standard Name

SFR1 (Sfi1 Repeat containing protein)

Aliases

PreTt25790 | 54.m00246 | 3823.m01157

Description

basal body localization; contains three Sfi1 repeats

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00463380

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_10719.15.998305401373361e-129hypothetical protein (213 aa)

General Information

Paragraph NoGene NameParagraph Text
47SFR1The gene model is incorrect. The cDNA sequence, as determined by RT-PCR, is: ATGAGTTTAGTTTAGAGAACAATATAGGCTTATGAGAAGGATGAAAACAAAAACTTCGAAGAGTTCATTGAAAAAAGTTTAAAAGCATTTAGAGAAGAAGGTATGAAATTCGAGTAGTAAAAGGAGTGCAATTCGTAATAAATGTCTGATAACTAAAGAAACGAATGGGAAGAAAAAATAGCTAGTTTGGAAAGTCTTTTTAAAATGTTTTGTGTGCTTAAAGGTTAAAAGAGAAAGAAATCAAGAGTCATGTATAACATTTGTGAGCATATTTATGGAAAGAATTTACTAAAAAGAACATTTTGGTGCTGGAAAAGCCACCAGAAGAATGAAGAATATCTGCGTTAGATGGAAGAGTAAGCAGATGTATTTTATAACAGAAGGACACTAACAAAAATAATGAGAAGTTGGTAAGATGTTGTAATTGATGAGAATAAAACAATAGTTAAAAACACTGCCTTAAAGAAAACTGAGTTAGAATTGCAAAAAAATCAAAAGGAGTTTGAAAACCAAATTAAGAGTTTGGAAATTTTGCTATAATAAAAAATATTAACACTGAGACATGAAGAATAACAATACAACATTTTATTCTAAAAATAATAGCTCCTTTCATAAAATTAAAAAATTGAATTTGATTGA The corresponding protein sequence is: MSLVQRTIQAYEKDENKNFEEFIEKSLKAFREEGMKFEQQKECNSQQMSDNQRNEWEEKIASLESLFKMFCVLKGQKRKKSRVMYNICEHIYGKNLLKRTFWCWKSHQKNEEYLRQMEEQADVFYNRRTLTKIMRSWQDVVIDENKTIVKNTALKKTELELQKNQKEFENQIKSLEILLQQKILTLRHEEQQYNILFQKQQLLSQNQKIEFD

Associated Literature

  1. Ref:27904881: Heydeck W, Stemm-Wolf AJ, Knop J, Poh CC, Winey M (2016) Sfr1, a Tetrahymena thermophila Sfi1 Repeat Protein, Modulates the Production of Cortical Row Basal Bodies. mSphere 1(6):

Sequences

>TTHERM_00463380(coding)
ATGAGTTTAGTTTAGAGAACAATATAGGCTTATGAGAAGGATGAAAACAAAAACTTCGAA
GAGTTCATTGAAAAAAGTTTAAAAGCATTTAGAGAAGAAGGTATGAAATTCGAGTAGTAA
AAGGAGTGCAATTCGTAATAAATGTCTGATAACTAAAGAAACGAATGGGAAGAAAAAATA
GCTAGTTTGGAAAGTCTTTTTAAAATGTTTTGTGTGCTTAAAGGTTAAAAGAGAAAGAAA
TCAAGAGTCATGTATAACATTTGTGAGCATATTTATGGAAAGAATTTACTAAAAAGAACA
TTTTGGTGCTGGAAAAGCCACCAGAAGAATGAAGAATATCTGCGTTAGATGGAAGAGTAA
GCAGATGTATTTTATAACAGAAGGACACTAACAAAAATAATGAGAAGTTGGTAAGATGTT
GTAATTGATGAGAATAAAACAATAGTTAAAAACACTGCCTTAAAGAAAACTGAGTTAGAA
TTGCAAAAAAATCAAAAGGAGTTTGAAAACCAAATTAAGAGTTTGGAAATTTTGCTATAA
TAAAAAATATTAACACTGAGACATGAAGAATAACAATACAACATTTTATTCTAAAAATAA
TAGCTCCTTTCATAAAATTAAAAAATTGAATTTGATTGA


>TTHERM_00463380(protein)
MSLVQRTIQAYEKDENKNFEEFIEKSLKAFREEGMKFEQQKECNSQQMSDNQRNEWEEKI
ASLESLFKMFCVLKGQKRKKSRVMYNICEHIYGKNLLKRTFWCWKSHQKNEEYLRQMEEQ
ADVFYNRRTLTKIMRSWQDVVIDENKTIVKNTALKKTELELQKNQKEFENQIKSLEILLQ
QKILTLRHEEQQYNILFQKQQLLSQNQKIEFD


>TTHERM_00463380(gene)
TTAAATAAAATCAAATCACAAATTCAAAAAATACAAAATTTAGAGTTTGATTAATATTTT
GTAAACATAGAATCATTATCAATAAACAAACAATAAATAGTTAGTTAGATAGATAGATTG
ATCGAGAGATAATAAAATAAACCAAAAATATTTGACTTGGAGGAGAAAATGAGTTTAGTT
TAGAGAACAATATAGGCTTATGAGAAGGATGAAAAGTAGAGCTCATTATTTTGTTTGTTT
ATTTTCTTTATGCTCTTATGTATTCTTATTCAGTGATTAAGCAAATTTTATTTAAATTAA
TAGCAAAAACTTCGAAGAGTTCATTGAAAAAAGTTTAAAAGCATTTAGAGAAGAAGGTAT
GAAATTCGAGTAGTAAAAGGAGTGCAATTCGTAATAAATGTCTGATAACTAAAGAAACGA
ATGGGAAGAAAAAATAGCTAGTTTGGAAAGTCTTTTTAAAATGTTTTGTGTGCTTAAAGG
TTAAAAGAGAAAGAAATCAAGAGTCATGTATAACATTTGTGAGCATATTTATGGAAAGAA
TTTACTAAAAAGAACATTTTGGTGCTGGAAAAGCCACCAGAAGAATGAAGAATATCTGCG
TTAGATGGAAGAGTAAGCAGATGTATTTTATAACAGAAGGACACTAACAAAAATAATGAG
AAGTTGGTAAGATGTTGTAATTGATGAGAATAAAACAATAGTTAAAAACACTGCCTTAAA
GAAAACTGAGTTAGAATTGCAAAAAAATCAAAAGGAGTTTGAAAACCAAATTAAGAGTTT
GGAAATTTTGCTATAATAAAAAATATTAACACTGAGACATGAAGAATAACAATACAACAT
TTTATTCTAAAAATAATAGCTCCTTTCATAAAATTAAAAAATTGAATTTGATTGA