Identifiers and Description

Gene Model Identifier

TTHERM_00138430

Standard Name

SFB2 (transport protein SFB2)

Aliases

PreTt24470 | 10.m00519 | 3698.m00236

Description

Sec23/Sec24 trunk domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF08181 ) DegQ (SacQ) family
  • ( PF04810 ) Sec23/Sec24 zinc finger
  • ( PF04811 ) Sec23/Sec24 trunk domain
  • ( PF04815 ) Sec23/Sec24 helical domain
  • ( PF08033 ) Sec23/Sec24 beta-sandwich domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00138430

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_05904.19.997093137033517e-262Sec23/Sec24 trunk domain-conta
ining protein (831 aa)
OxytrichaContig903.1.g863.0008389609965914e-128Sec23/Sec24 trunk domain
DictyBaseDDB_G02812552.0006821221283624e-88sec24 on chromosome: 3 positio
n 4298212 to 4301618
WormBaseWBGene000047563.000298514542485e-73locus:sec-24.2 status:Partia
lly_confirmed UniProt:Q23368
protein_id:CAA92988.3
SGDYIL109C1.0002758036576784e-62SEC24 Component of the Sec23p-
Sec24p heterodimer of the COPI
I vesicle coat, required for c
argo selection during vesicle
formation in ER to Golgi trans
port; homologous to Sfb2p and
Sfb3p
Stentor CoeruleusSteCoe_229625.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00138430(coding)
ATGAGTATTCACCAAAAGATGCTAGCAAAGCACTAGCAAAATAATTAGAACTAGCAATAT
GAATAAACTGGATAAAATCAAAGTATTTAAGCTCCATCATTGAATTAACAACAATAAGAT
TATCAGTCTCAAAATACCACATCTGGCAATACAGGTCCTTTTGTATAATAGAATAACAAT
ATGTAATAAGGATAATATCAAAATAATGCTCAATACTAAAACGTTTACTAACAAAGTATG
CAATATAATAATAATTTAGGAGGATATGTTCAGAATATAAATGAGAAAAATTAAATAGAA
GAAATTTAATAATGGGCAGAAAACTTCAATGCACCTAAATTATATGTCAGAAGTACTACT
GACTGCTTTCCTAAATCAAAAAAATTATATCAAGATTCAAATTATAAATTTGCTTTGATC
ATACAGCCTTATGGTTCTCAAGATGTAGATTTTCCAGTAGCTTCAACTAAATGCAAAAAT
ATTATTAGGTGTGACAATTGCCGTGCCTATCTAAATCCATTTTGTAGATTTATGAATGAT
GGATATAAATATAAATGCAACATTTGTGATAGATTTGAAAGTGTGCCTAATTTTTACTAT
AGTCCACTTGACGAAAACGGATATAGAAAAGACATGTATGATAGACCTGAGCTTTGTTAT
GGTTCTTTTGATATAATTGCAGGTCAAGATTATGTTGCAAGACCTCCAATGCCTCCAACT
TTTTTCTTCTTGATCGATGTTTCTAAAGCTTCTGTAGAATCTGGAATGCTTAGTGTAATT
TCAAATCAAATAAAGGCAACAATTAATGATTAGCTTTTAGCAGGAAAAGAAAGAACATAA
GTAGGGTTTGTGACTTATGATAGCAAGATACATATTTATAATTTAAAATCTTCTCTAAAA
TAACCTTAAATGTTTGTTTTATCTGATCTCACTGATATAGAAATTCCAATTCCTGATGAT
TTGATTGTCACCTTAAGTGATTCTAAAGATCTTGTCTTGAACCTCCTCGATTCGTTACCT
AAAATGTTTGAAAACACACAAATAAATGAAAGTTGTTTAACTTTTGCTTTAAATACTGTA
AATAAAATCATTTAAACTGTGGGTGGTAGACTTTTTATCTTCTAAAATAGTGCTTCAATT
ATCAATGAGCCTGTATTTTAAAGCAAATAAGATCCTAATAAAAAACCTTAGCCTGGTGAG
ACCCTCTAATATTAATATCAATTACCAGCTTCATCTCACTTTAGAAATGTCTGCTCTGAA
ATGCACATCAATTTCATCAATCCTTCAATTTTTATTTTCTCTGATACTTTTAAAAATGCA
ATTACTCTTGGAGAACTAGCAAGATTCCTTAATGGAGACATATTTTATTATTATGATAAG
CTGACAAGATAATAGCAATTAGAGTAAGATTTGAAGTATTCCTTAGAAAAATCAATGTCC
TGGGAAAGTGTATTTAGAATTCGTATTACTCAAGGATTTAGAATTACTAATGTTATCGGA
AATTTCTCAGTAAAGTCAACAGATCTTTTATCATATCCTTGTGATGAGAACAAGTCTTTA
ATTTATGAAATCGAGATGGATGACACAATAGCAAGAGGAACAAACTTATCAATTTAAACT
GCTTTGTTATACACAACAAGTGATGGAGAAAGAAGAATTAGATCACATAATTATATTATT
CCTCTCACTTCAGATCCTTATGATATTTACAAACAAGCTGATTGCTCAGCTTTAACTGCC
TACCTTGCAAGAAATGCAATAAGCAAAATATATCTTTAACCAATATCAAATTTAAAAGCA
GAACTAATTGGAATTACTAAAAGAATTTGTTCGAGTGCTATAAGCGTTAATTAAAAACAA
CTACCTGATAACTTAGCCTAACTTCCTCTTAATGTATTGGGAATTATGAAGCATGCAATA
TTCACAAGCAACTATTAAAATACACCATTTACTGACTTCATAAACGTTTAAAGACTTTAA
TTTAATTCTATGCCTGTTGATGAATTGCTTGTTCATTTTGTGCCCTACTTATTCTGTATC
GATGATATGAAAGATGAAAATGTGTCATACATTGATGATTAAGGGTTATTTGTATATCCA
TAATCATCCTTAACAGCATTCAGCTCATTAGGAAAAACAATTTATCTAATGGATTTAGGA
CAATAGCTTATATTATATATTAATACAAACGGTACTGATTGGAATTACATTACAGACGTA
ATTGGATCCACAGACTTTAGTTAAGTTTTCACAGAGGAAAACCTCTATGCAAATACACAT
AACAGAATAAATGAATAGTTATCAAATTTAATTTAGGAACTAAGAAAGAGAAAGAGTACA
AAATATTGTCCTCTAAATATAGTTATAGCTGGTACTGGTTCACCTTTAGAAAATTTGTTC
TATTACAAACTGGTTGAAGATAAATACGTTAATTACTCTATGGGCTATAATGCTAGTTAT
GAAGAGTTTATTAAATTTTTGATGTGA


>TTHERM_00138430(protein)
MSIHQKMLAKHQQNNQNQQYEQTGQNQSIQAPSLNQQQQDYQSQNTTSGNTGPFVQQNNN
MQQGQYQNNAQYQNVYQQSMQYNNNLGGYVQNINEKNQIEEIQQWAENFNAPKLYVRSTT
DCFPKSKKLYQDSNYKFALIIQPYGSQDVDFPVASTKCKNIIRCDNCRAYLNPFCRFMND
GYKYKCNICDRFESVPNFYYSPLDENGYRKDMYDRPELCYGSFDIIAGQDYVARPPMPPT
FFFLIDVSKASVESGMLSVISNQIKATINDQLLAGKERTQVGFVTYDSKIHIYNLKSSLK
QPQMFVLSDLTDIEIPIPDDLIVTLSDSKDLVLNLLDSLPKMFENTQINESCLTFALNTV
NKIIQTVGGRLFIFQNSASIINEPVFQSKQDPNKKPQPGETLQYQYQLPASSHFRNVCSE
MHINFINPSIFIFSDTFKNAITLGELARFLNGDIFYYYDKLTRQQQLEQDLKYSLEKSMS
WESVFRIRITQGFRITNVIGNFSVKSTDLLSYPCDENKSLIYEIEMDDTIARGTNLSIQT
ALLYTTSDGERRIRSHNYIIPLTSDPYDIYKQADCSALTAYLARNAISKIYLQPISNLKA
ELIGITKRICSSAISVNQKQLPDNLAQLPLNVLGIMKHAIFTSNYQNTPFTDFINVQRLQ
FNSMPVDELLVHFVPYLFCIDDMKDENVSYIDDQGLFVYPQSSLTAFSSLGKTIYLMDLG
QQLILYINTNGTDWNYITDVIGSTDFSQVFTEENLYANTHNRINEQLSNLIQELRKRKST
KYCPLNIVIAGTGSPLENLFYYKLVEDKYVNYSMGYNASYEEFIKFLM


>TTHERM_00138430(gene)
ATGAGTATTCACCAAAAGATGCTAGCAAAGCACTAGCAAAATAATTAGAACTAGCAATAT
GAATAAACTGGATAAAATCAAAGTATTTAAGCTCCATCATTGAATTAACAACAATAAGAT
TATCAGTCTCAAAATACCACATCTGGCAATACAGGTCCTTTTGTATAATAGAATAACAAT
ATGTAATAAGGATAATATCAAAATAATGCTCAATACTAAAACGTTTACTAACAAAGTATG
CAATATAATAATAATTTAGGAGGATATGTTCAGAATATAAATGAGAAAAATTAAATAGAA
GAAATTTAATAATGGGCAGAAAACTTCAATGCACCTAAATTATATGTCAGAAGTACTACT
GACTGCTTTCCTAAATCAAAAAAATTATATCAAGATTCAAATTATAAATTTGCTTTGATC
ATACAGCCTTATGGTTCTCAAGTAAAAATAATTATTGCTTTTATTAATGAATGAAAAATG
TTTAATAAGATGAAATTATTTATGGCATTTTTTTAAATATAATTTTATGAATGAATGAAT
GAATAAATAAATAAATAAATAATTATAAAATTAGGATGTAGATTTTCCAGTAGCTTCAAC
TAAATGCAAAAATATTATTAGGTGTGACAATTGCCGTGCCTATCTAAATCCATTTTGTAG
ATTTATGAATGATGGATATAAAGTAATTATTATTTTATTTGTAAAACTTTCAATATAAAG
ACTAATAAAATAAGCAACAACTTTGAGATAAATTTATTATTAAAAGTAAAATGTAATTGC
AAATATTCTATTTTTTTTATTAAAATTAACAAGTATAAATGCAACATTTGTGATAGATTT
GAAAGTGTGCCTAATTTTTACTATAGTCCACTTGACGAAAACGGATATAGAAAAGACATG
TATGATAGACCTGAGCTTTGTTATGGTTCTTTTGATATAATTGCAGGTCAAGAGTAATTA
TTCTTACAGTATTCCTTTGAAAAATAAAATAGTTGATTAATTTAAAATATATAGTTATGT
TGCAAGACCTCCAATGCCTCCAACTTTTTTCTTCTTGATCGATGTTTCTAAAGCTTCTGT
AGAATCTGGAATGCTTAGTGTAATTTCAAATCAAATAAAGGCAACAATTAATGATTAGCT
TTTAGCAGGAAAAGAAAGAACATAAGTAAATTTTATAAATAAAATTAGGATAAGCATAAT
TATAATCATTTTTTAAATTTTATTAAGGTAGGGTTTGTGACTTATGATAGCAAGATACAT
ATTTATAATTTAAAATCTTCTCTAAAATAACCTTAAATGTTTGTTTTATCTGATCTCACT
GATATAGAAATTCCAATTCCTGATGATTTGATTGTCACCTTAAGTGATTCTAAAGATCTT
GTCTTGAACCTCCTCGATTCGTTACCTAAAATGTTTGAAAACACACAAATAAATGAAAGT
TGTTTAACTTTTGCTTTAAATGTAATCTATAATTTGATTCATTCAAAAAGTTAATTTTTT
AACTAAATTAATTATTAAAAAGACTGTAAATAAAATCATTTAAACTGTGGGTGGTAGACT
TTTTATCTTCTAAAATAGTGCTTCAATTATCAATGAGCCTGTATTTTAAAGCAAATAAGA
TCCTAATAAAGTAAATATTTTATAGGCTAAATAAAAAAACAAAAACTTTTTAATTTAAAT
ATTCAAAAGAAACCTTAGCCTGGTGAGACCCTCTAATATTAATATCAATTACCAGCTTCA
TCTCACTTTAGAAATGTCTGCTCTGAAATGCACATCAATTTCATCAATCCTTCAATTTTT
ATTTTCTCTGATACTTTTAAAAATGCAATTACTCTTGGAGAACTAGCAAGATTCCTTAAT
GGAGACATATTTTATTATTATGATAAGCTGACAAGATGTAAATATCTTTAAATAACCTTC
TTATAAATTTATAAATATATTATTTAAAATTAGAATAGCAATTAGAGTAAGATTTGAAGT
ATTCCTTAGAAAAATCAATGTCCTGGGAAAGTGTATTTAGAATTCGTATTACTCAAGGAT
TTAGAATTACTAATGTTATCGGAAATTGTAATTAAATATTTTACTTATACAACCATTTTT
ATTTTAATAAAACATAATAGTCTCAGTAAAGTCAACAGATCTTTTATCATATCCTTGTGA
TGAGTAATTAATTAATTCATTCATTACTTTCTTAATTCCATAAATATTTGCTTACTTACT
TATTATTTATTTTAAGAATTGAAGATTTATTTACGTTAATTATTTAAAATTTAGGAACAA
GTCTTTAATTTATGAAATCGAGATGGATGACACAATAGCAAGAGGAACAAACTTATCAAT
TTAAACTGCTTTGTTATACACAACAAGTGATGGAGAAAGAAGAATTAGATCACATAATTA
TATTATTCCTCTCACTTCAGATCCTTATGATATTTACAAACAAGCTGATTGCTCAGCTTT
AACTGCCTACCTTGCAAGAAATGCAATAAGCAAAATATATCTTTAACCAATATCAAATTT
AAAAGCAGAACTAATTGGAATTACTAAAAGAATTTGTTCGAGTGCTATAAGCGTTAATTA
AGTAAGATTAAGTAAGTATCTATGAATTTTAATTAAAATTTATTGAATAAAAATAGAAAC
AACTACCTGATAACTTAGCCTAACTTCCTCTTAATGTATTGGGAATTATGAAGCATGCAA
TATTCACAAGCAACTATTGTAAAAAATTTTATTAATAAATAATATCTAAAAATATAAACA
TAAAAAAGAAAATACACCATTTACTGACTTCATAAACGTTTAAAGACTTTAATTTAATTC
TATGCCTGTTGATGAATTGCTTGTTCATTTTGTGCCCTACTTATTCTGTATCGATGATAT
GAAAGATGAAAATGTGTCATACATTGATGATTAAGGGTTATTTGTATATCCATAATCATC
CTTAACAGCATTCAGCTCATTAGGAAAAACAATTTATCTAATGGATTTAGGACAATAGCT
TATATTATATATTAATACAAAGTATTTTATTTATTTTTTAAATAATTAATCTAAATCATA
ATTTAATCAACCTAACTAACAGCGGTACTGATTGGAATTACATTACAGACGTAATTGGAT
CCACAGACTTTAGTTAAGTTTTCACAGAGGTAAATAAATAATTAAATTTAAAAATGTTTA
AAGCAATTAATAATCTTACTTTTTTATAAAGGAAAACCTCTATGCAAATACACATAACAG
AATAAATGAATAGTTATCAAATTTAATTTAGGAACTAAGAAAGTATATATAATTTGAAAA
GTCTTCCATATTTAATATTTTAAATTATTTTTAAAGGAGAAAGAGTACAAAATATTGTCC
TCTAAATATAGTTATAGCTGGTACTGGTTCACCTTTAGAAAATTTGTAATTTTTAAAAAT
AATAAATATAAATAAATAAATAAATATAATATTAAATATTTTCAAAGGTTCTATTACAAA
CTGGTTGAAGATAAATACGTTAATTACTCTATGGGCTATAATGCTAGTTATGAAGAGTTT
ATTAAATTTTTGATGTGA