Identifiers and Description

Gene Model Identifier

TTHERM_00775870

Standard Name

SERJ (SerJ surface antigen; glycosyl phosphatidyl inositol (GPI)-linked cell surface antigen; regulated pr)

Aliases

PreTt21100 | 129.m00071

Description

hypothetical protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01500 ) Keratin, high sulfur B2 protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: Yes
Presense Probability: 75.6%

TetraMine Data

TTHERM_00775870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:11080598: Doerder FP (2000) Sequence and expression of the SerJ immobilization antigen gene of Tetrahymena thermophila regulated by dominant epistasis. Gene 257(2):319-26

Sequences

>TTHERM_00775870(coding)
ATGAATAAATTGTTTACTATTACTTTAGTGGTATATTGTTTCATATCTAATACTTATGCC
TCACCTACTTTTGGTAAGTATGTTCATTGCTCAAGTAACGGAAGTGATTGCACTGGATGT
GGTGCTGGTGCTACTGATGTTAGTGGTGCTTAGGATTTATTCACATATTCTTCAGGTAAT
AAATGTTTATTTCTTGATTGCTCAGTAACTGTTGATGCAACAAAATTAAATGGCTGGATA
TGTGCTTCTTGCAATGGAGTTAATAATAGTATTGTACCTCCAAGAAAATATTTTTAAGGT
GGTACTTGTGTTGCTTCTTGCACTCCACCTGCTACTGCTACCTCCGACTAAATTTGTTAC
TCACCTGCTGTTGGTAATGCTGTCCCTTGCTCAAGCAACGGAAGTGGTTGCACTGGATGT
GGTGCTGGTGCTACTGATGTTAGTGGTGCTTAGGCTTTATTCACTTAAGTTTCAGGTAAA
AACTGCGTATTTGCTGATTGCTAAGCAACTGTTGCTGCAACAAGTTCTAGTTGTGCTGCT
TCTTGCACAGCACCTAATGTTCCTAACACCAACTAAATTTGTTAGAAACCTCCTGCTGTT
ACTGGTAATAATGTTGCTTGCTCAACTAATGGAACAGATTGTACAGGATGTGGAGCTAAT
GCTACAATTTAAGGATTATTTACTTATGTTTCAGGTAATGTCTGCAAAATTACAGACTGT
TCTTCAACTACCACCTCTAATGCTGCTAATTTGAATGGTTGGGTTTGTAATTTTTGCAAT
GGTTAGACTGGTTCCACTGTTCCTGCTGGTTCATAATTTTCTGGATCAACATGCGCTACT
TCTTGCCCTTCTGGCCAAACTACTTCTGCCTCAAACTCATTTACTTGCACTGCTGGTTCT
TCAACTAATGCTAGCGTTGTAATTTATTTATTAAGAAAAGGAAAATTTAACATAAATATT
TAACATATGGAAGAAATCAGGGATCACCAAGAAGAAGCCAGTATACTTGTTTTTTATTGA


>TTHERM_00775870(protein)
MNKLFTITLVVYCFISNTYASPTFGKYVHCSSNGSDCTGCGAGATDVSGAQDLFTYSSGN
KCLFLDCSVTVDATKLNGWICASCNGVNNSIVPPRKYFQGGTCVASCTPPATATSDQICY
SPAVGNAVPCSSNGSGCTGCGAGATDVSGAQALFTQVSGKNCVFADCQATVAATSSSCAA
SCTAPNVPNTNQICQKPPAVTGNNVACSTNGTDCTGCGANATIQGLFTYVSGNVCKITDC
SSTTTSNAANLNGWVCNFCNGQTGSTVPAGSQFSGSTCATSCPSGQTTSASNSFTCTAGS
STNASVVIYLLRKGKFNINIQHMEEIRDHQEEASILVFY


>TTHERM_00775870(gene)
ATGAATAAATTGTTTACTATTACTTTAGTGGTATATTGTTTCATATCTAATACTTATGCC
TCACCTACTTTTGGTAAGTATGTTCATTGCTCAAGTAACGGAAGTGATTGCACTGGATGT
GGTGCTGGTGCTACTGATGTTAGTGGTGCTTAGGATTTATTCACATATTCTTCAGGTAAT
AAATGTTTATTTCTTGATTGCTCAGTAACTGTTGATGCAACAAAATTAAATGGCTGGATA
TGTGCTTCTTGCAATGGAGTTAATAATAGTATTGTACCTCCAAGAAAATATTTTTAAGGT
GGTACTTGTGTTGCTTCTTGCACTCCACCTGCTACTGCTACCTCCGACTAAATTTGTTAC
TCACCTGCTGTTGGTAATGCTGTCCCTTGCTCAAGCAACGGAAGTGGTTGCACTGGATGT
GGTGCTGGTGCTACTGATGTTAGTGGTGCTTAGGCTTTATTCACTTAAGTTTCAGGTAAA
AACTGCGTATTTGCTGATTGCTAAGCAACTGTTGCTGCAACAAGTTAAAATGGTTGGATG
TGTGCTTCTTGCAATGGAGTTTCTAATAGTAAGGTACGTCTATGAAATGTTTATTCAGGT
TCTAGTTGTGCTGCTTCTTGCACAGCACCTAATGTTCCTAACACCAACTAAATTTGTTAG
AAACCTCCTGCTGTTACTGGTAATAATGTTGCTTGCTCAACTAATGGAACAGATTGTACA
GGATGTGGAGCTAATGCTACAATTTAAGGATTATTTACTTATGTTTCAGGTAATGTCTGC
AAAATTACAGACTGTTCTTCAACTACCACCTCTAATGCTGCTAATTTGAATGGTTGGGTT
TGTAATTTTTGCAATGGTTAGACTGGTTCCACTGTTCCTGCTGGTTCATAATTTTCTGGA
TCAACATGCGCTACTTCTTGCCCTTCTGGCCAAACTACTTCTGCCTCAAACTCATTTACT
TGCACTGCTGGTTCTTCAACTAATGCTGTTAAAATTACATTTACAATCTTATTTGCTATT
TTTGGATTATTAATCTGATTTTACATTTAATAAATTCCTTTTAAAATATTTATTGTTCTT
CTTCATAAATTTATATGTTCTTTTTAGAGCGTTGTAATTTATTTATTAAGAAAAGGAAAA
TTTAACATAAATATTTAACATATGGAAGAAATCAGGGATCACCAAGAAGAAGCCAGTATA
CTTGTTTTTTATTGA