Identifiers and Description

Gene Model Identifier

TTHERM_00316560

Standard Name

SEP2 (SEPtin 2)

Aliases

PreTt20967 | 31.m00269 | 3687.m00071

Description

SEP2 septin protein; Septin 2- Cell division protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.7%

TetraMine Data

TTHERM_00316560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_08421.19.997093137033517e-262cell division protein (570 aa)
WormBaseWBGene000067935.001425520048966e-32locus:unc-59 status:Confirme
d UniProt:Q9U334 protein_i
d:CAB63329.1
OxytrichaContig4578.0.g74.001033848388204e-30Septin
SGDYCR002C2.000130478826482e-26CDC10 Component of the septin
ring that is required for cyto
kinesis; septins recruit prote
ins to the mother-bud neck and
can act as a barrier to diffu
sion at the membrane, and they
comprise the 10 nm filaments
seen with EM; required for the
transition from a single to d
ouble septin ring
Stentor CoeruleusSteCoe_272785.242885663363464e-22
DictyBaseDDB_G02923180.0004999512321494991rsmD on chromosome: 6 position
1471614 to 1472506

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18586950: Wloga D, Strzyzewska-Jówko I, Gaertig J, Jerka-Dziadosz M (2008) Septins stabilize mitochondria in Tetrahymena thermophila. Eukaryotic cell 7(8):1373-86

Sequences

>TTHERM_00316560(coding)
ATGGACAATCAAAGAGTTCCATTTCCAACAAAAGCAACAAATAACCCAAATTAATTCTTT
TCGGCTTTCGAAAGAAATCAAAATGAATCAGGAGAATAGATATTCAATCGAACTTTTACC
AGAAGCATTGAATCAAGTCATTGGGATAATGATAATTCTAACTTGTTGGCTGATTTAGAG
GAACTTGATTAAATTAAATAAAAACAAGCAGATCAAAGAAACTCAAATAAAAATGATTTT
TCAAAGTTAGATAAATAATATTTGAACGAGATGCTCTAATAGTAGTAAAAAAAAATAGGC
AACATTTTAGAAGTGAGCTCACCTCAAAAAAGCAGTCCATAAATACCTTAAAAATAAGAA
AATACTTTCTTTCCTGATCAAGATTTAAAGTTTAAAAAGCAAACAAGTTAAAAAAGATCT
GCCCTCTAAGGATCCTTTAATATGTTCCATGGCAAAGATGATAACAGACTAGGGGAAACC
TTAATTTCTGAATATGTCAGCGAAGACTTCCACAGTTAACACAATTCACCCTTAAAAGAG
TTAGTTATCACTTAGACTTAGGTTGGCGGAAACAATTAAAATAATCCCTCTTATTTACAT
ACAAATCAAAATCAAAATTAACTAAGTGTTTTGATAAGCTAATAAGAAGATAATGCATAG
TCTACTTCACATGTTCATAACGAATAATCAGTGCTTTCTATTCTAAAAGAGCATGAGCTT
GAAAAACCTGTATATATAAACGTTATGGTTGCGGGAGCTCAAGGCTTAGGAAAATCTACT
TTTATTGATGCATTTCTCAATAAGAAATTTCATAAAGAATAGCCTGACGTCATCAGACCA
AAGACAGAGGAAATTGTTGAAGTAACTGGCATTCGTACTGAAAACAAAATAAAATTGCAC
TTAAATATGATCGATACACCTGGATACTCTGAAGAAACAAACATTGATGAATGGATTGAT
AAAATTATTAAACATATCGTGGGCAAGTTTGAGAATTACAAATTATTTGAAGATAAATTG
ATCGAAGATATAAAAAGTGTTTAGTAGGAAGATGATAAAGATTGCAGGGTACACGTTTGT
CTCTATTTTATATAAGGAAGAAGCATTTCTAAATTTGATTAAAAAGCTATTCTCAAACTT
TAAGAACATGTTAGCATTATTCCTATCTTAGCAAAAGGAGATACTTACATGATTGAAGAA
GTGAAATAAATCAAGCAAAATATTATTAAAGATGCACATGATAATAAAATAAGCTTTTTT
GATTGTGAAGCACCCTTAAAGAACGATAAAGAAAGACTCTAAAAATTGAGGAATGGACCT
TTTGGACATTCTCCACCATTCCTTATGATATCTTCTGTATAAAAAATAGAAATAGAAAAA
TAAAAAATATATGCAAGAAAATACCCTTGGGGAATATGTAAAATAGAAGATCCAGAACAT
TCTGATTTCTTGCTTCTTTATCAACTTTTGATTGGATACTTCATCGCTGATCTTAAGAAA
CTAACTGATATTATCTACAAGCAATATTTGAAAAAGAAGAAAAAATAAATAAAAGAAGAA
AAGAAAAATAAATAGAATCAGAAATTAATTGGAGGAGGTGTTGCCTTAGCCATAGCAGGA
TTACTTGGCTTTATCAAATATTAAGCCATTAAATGA


>TTHERM_00316560(protein)
MDNQRVPFPTKATNNPNQFFSAFERNQNESGEQIFNRTFTRSIESSHWDNDNSNLLADLE
ELDQIKQKQADQRNSNKNDFSKLDKQYLNEMLQQQQKKIGNILEVSSPQKSSPQIPQKQE
NTFFPDQDLKFKKQTSQKRSALQGSFNMFHGKDDNRLGETLISEYVSEDFHSQHNSPLKE
LVITQTQVGGNNQNNPSYLHTNQNQNQLSVLISQQEDNAQSTSHVHNEQSVLSILKEHEL
EKPVYINVMVAGAQGLGKSTFIDAFLNKKFHKEQPDVIRPKTEEIVEVTGIRTENKIKLH
LNMIDTPGYSEETNIDEWIDKIIKHIVGKFENYKLFEDKLIEDIKSVQQEDDKDCRVHVC
LYFIQGRSISKFDQKAILKLQEHVSIIPILAKGDTYMIEEVKQIKQNIIKDAHDNKISFF
DCEAPLKNDKERLQKLRNGPFGHSPPFLMISSVQKIEIEKQKIYARKYPWGICKIEDPEH
SDFLLLYQLLIGYFIADLKKLTDIIYKQYLKKKKKQIKEEKKNKQNQKLIGGGVALAIAG
LLGFIKYQAIK


>TTHERM_00316560(gene)
ATGGACAATCAAAGAGTTCCATTTCCAACAAAAGCAACAAATAACCCAAATTAATTCTTT
TCGGCTTTCGAAAGAAATCAAAGTAAAATCGCACATTTATTAAATAAAATCTTTTATTAA
AAAATTTTATATTTGATTTAGACAACAGAAACAATCCATATAATCTAGGTAGAAAAATAC
TATTTTACTTGTTTGTTTCTTTATTTACTTGATTTTGCTCTATAAATTTTGTTATACTTT
TTGATAAATACAAAATCAACTAAATCCTATATTAAGTAAATCTATTAGTTTAGAAAGAAA
ATAAAAGAAAATCAGTCACTGATTCTTTCTAAATGACTATTATTCACTAATCAATTAATT
AATTGATTGATTTATAGATTTACTTAGAACAACTGTCTCATTTCCTTTGGATTCAAAATA
GCTTTCATTTAATTCCAATCCTCCAGAAATTAAAAATTTTTTGATGATTGCTAGCTAAAC
ATTTCATTAAATCTTTTTGGCAATATTATTTTTCTTTTTCTAAATTAATTTGATTAACTC
CATTTGTTTGTCAATCTATTTTTGATAAGTTAGCGCTATTTGAACCAATCAAAATTCAAA
AAAAACCTTTATAATAAGCAAGACTAGTTATATGAAACTAGGAAAATAATATCAAAACTG
AACTCAAATTTATTTTTAATGCTAAAAATTTACTCATTACAATAATTATATATTTAGATG
AATCAGGAGAATAGATATTCAATCGAACTTTTACCAGAAGCATTGAATCAAGTCATTGGG
ATAATGATAATTCTAACTTGTTGGCTGATTTAGAGGAACTTGATTAAATTAAATAAAAAC
AAGCAGATCAAAGAAACTCAAATAAAAATGATTTTTCAAAGTTAGATAAATAATATTTGA
ACGAGATGCTCTAATAGTAGTAAAAAAAAATAGGCAACATTTTAGAAGTGAGCTCACCTC
AAAAAAGCAGTCCATAAATACCTTAAAAATAAGAAAATACTTTCTTTCCTGATCAAGATT
TAAAGTTTAAAAAGCAAACAAGTTAAAAAAGATCTGCCCTCTAAGGATCCTTTAATATGT
TCCATGGCAAAGATGATAACAGACTAGGGGAAACCTTAATTTCTGAATATGTCAGCGAAG
ACTTCCACAGTTAACACAATTCACCCTTAAAAGAGTTAGTTATCACTTAGACTTAGGTTG
GCGGAAACAATTAAAATAATCCCTCTTATTTACATACAAATCAAAATCAAAATTAACTAA
GTGTTTTGATAAGCTAATAAGAAGATAATGCATAGTCTACTTCACATGTTCATAACGAAT
AATCAGTGCTTTCTATTCTAAAAGAGCATGAGCTTGAAAAACCTGTAAAAATTGCTATAT
TTTATTAATTCATTATTTATTTATTATTCTCCTATTTTGAATCTTAGAATTAACTTGCCA
TTTTTTTTTCTTTTTTGCAGTCAGTGCATTTCATAAAAAACTTTTATTTAACATTTGAAA
ATAAACAATTGTTCAAAAGACGAAAATTTGGTCATCAAAAATTTTTTCTCTTAACTCTTT
ATTTGAGCTTCATGATCAATTAATCAATCTTAGCTAAATTTTTAACATTTGTATTATTTT
ATACATTTACTGCTCTTAAATTTTAAATAAAAAAGTTGACTTTTTAATGTTCTTAGAAAC
ACTATTACGATGAAGCTATTAGCTTTACAAGCCTTTCATTTTGATTTAAAATAAATAAAT
CATTTTAATCTTTCAATAAATAAATGAATAAATTATGATCAAATGATTGCAATTTTTATG
ATTTTTAAATTATCAGATTTGTTTGATATTAATTTTACAATATTACTGTTATAGCGCTCA
ACTTTATTAGCAATTATATATCAAAATTTAAAATTTAGGAGTTTTTAAAATAGTATGAAA
TAAATAACATCACTCTAAAATATTTCAATCACGTTAAAATAATTATTGAATTAATTAAAA
AGGTATATATAAACGTTATGGTTGCGGGAGCTCAAGGCTTAGGAAAATCTACTTTTATTG
ATGCATTTCTCAATAAGGTATTTATTACATTAAATCTAAAATAGATCAGCCTATTTTTTA
AATTCTTCAAATATTATTCTTAGTGCTATACAAATATAAATTTGTGATATAGTAATTAAT
AATCAAAATATCGGGAAAAAAAGATAATCAGTCACTAAAATTAATTACTTTATCTATTTG
ATCTAACAAAATTTTAAAATAATCTGATTTATTATCATCGATCGCCTTTGTTTTGTATTA
ATTTATTTTTTGTCATCCAAAAAGAAATTTCATAAAGAATAGCCTGACGTCATCAGACCA
AAGACAGAGGAAATTGTTGAAGTAACTGGCATTCGTACTGAAAACAAAATAAAATTGCAC
TTAAATATGATCGATACACCTGGATACTCTGAAGAAACAAACATTGATGAATGGATTGAT
AAAATTATTAAACATATCGTGGGCAAGGTAAAGCAGACAAATTAAATTTACAAATTTTGA
GTTTCATTATTGTTTGTTAATTTTTTTTCTATCTCAAAAAATTTAAAAATACGTTTTTAA
TTTATTTTTAAATTGAACAAATTTTTAATGAGTTCTCAATGCAGTTTTACTGTTGAATAA
TGAATGACATTCTTAAATAAATTATATAACTGTTAATAAATAGTTTGAGAATTACAAATT
ATTTGAAGATAAATTGATCGAAGATATAAAAAGTGTTTAGTAGGAAGATGATAAAGATTG
CAGGGTATTTATTTAAATACTATTACTTTTGATATGTGTTTTAGATAATTAATTTAACAT
GGTTCTTTTTAAATATTAAAGGTACACGTTTGTCTCTATTTTATATAAGGAAGAAGCATT
TCTAAATTTGATTAAAAAGCTATTCTCAAACTTTAAGAACATGTTAGCATTATTCCTATC
TTAGCAAAAGGAGATACTTACATGATTGAAGAAGTGAAATAAATCAAGCAAAATATTATT
AAAGATGCACATGATAATAAAATAAGCTTTTTTGATTGTGAAGCAGTAATTAATATTTTA
TCATTTATCAAATTTAAAAATTATAATTTTAAATATTTTAAATACATTTTTACAAAAAAT
CATTAGCCCTTAAAGAACGATAAAGAAAGACTCTAAAAATTGAGGAATGGACCTTTTGGA
CATTCTCCACCATTCCTTATGATATCTTCTGTATAAAAAATAGAAATAGAAAAATAAAAA
ATATATGCAAGGTAACATAATCTAAACATTTATTTTTTTATTTCAAAATCATAAATAATC
TTAAAAAGTAAATGTGCTTGTTTAATATATACTTTTTTATTGATAGAAAATACCCTTGGG
GAATATGTAAAATAGAAGATCCAGAACATTCTGATTTCTTGCTTCTTTATCAACTTTTGA
TTGGATACTTCATCGCTGATCTTAAGAAACTAACTGATATTATCTACAAGCAATATTTGA
AAAAGAAGAAAAAATAAATAAAAGAAGAAAAGAAAAATAAATAGAATCAGAAATTAATTG
GAGGAGGTGTTGCCTTAGCCATAGCAGGATTACTTGGCTTTATCAAATATTAAGCCATTA
AATGA