Identifiers and Description

Gene Model Identifier

TTHERM_00011340

Standard Name

SEN2 (putative helicase SEN2)

Aliases

PreTt11740 | 1.m00788

Description

putative helicase required for processing of tRNAs, rRNAs, and small nuclear RNAs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00011340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02812.19.997093137033517e-262hypothetical protein (1812 aa)
OxytrichaContig9372.0.1.g135.001102406662288e-90AAA domain
SGDYLR430W2.9997879492220375e-71SEN1 Presumed helicase require
d for RNA polymerase II transc
ription termination and proces
sing of RNAs; homolog of Senat
axin which causes Ataxia-Oculo
motor Apraxia 2 and a dominant
form of amyotrophic lateral s
clerosis
DictyBaseDDB_G02852434.000989088096131e-71DDB_G0285243 on chromosome: 4
position 2998910 to 3005650
WormBaseWBGene000048805.997992534675281e-52locus:smg-2 Regulator of non
sense transcripts 1 status:C
onfirmed UniProt:O76512 pr
otein_id:CCD73461.1
Stentor CoeruleusSteCoe_144613.3057006267607343e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011340(coding)
ATGAGTAATTATTTTAACTCTTCTTCTAATGGCTAGAAGAGTTATTAATAGTAGTAGCAG
TAGCGTAGCTTATCATTTTTGTCTTAATAGATAGACTAAAATGATTAGTAAAAAAGAGGA
ATTGAATATTATTTTTCAAAGTAAAAAAATTAAAACAATGGCGTTGATAGAATGTTAGAT
GGTATTAAAGAATTTTAGTATGAGAACAAAGAAGAAGATAAAAGTTAAATCACTAATCAT
TCTTTTAAGAGGTAAGGAGGTGCTTAAATGACTTTGGATTTCTTTTCTGGGGCTTTACCA
AAAAATACTTCCCATCTACAAAATATCATAACATCAAAGTAGAATACATAAAATAGTTAG
AATCATAGTAAAAGTAATTAGAACTATAGCATAATTATTGATGAGTTTGAAAGAAACAAC
AATAGCGATGATAATGATGATATTTCAGAAGTTTAAGATATTGGACCATTTACAAAGAGA
CCATAGGCAAAGCAATAAATAAATATAGAAGACGATGATGATGATATTGATGATTCAATA
GAAATATTACCAGAAGGAGATTTAACTGCAAACAATTAATTGAAATAAAATGGAAATAGT
TTACTATCTTCACTTCTTAGTAGGCAATAAAAGAACAATAGTAATAATAGTAATAATGGA
AGTATTGTTTAGAGGAGCTTGATGCCTAATTAGATTTTTATGCCTAAACATTCTAATTCC
TAGGAAAATTAATTTGGCTCTTCTAAAGAAATTTTCAATTTTTAGAGTAATAGTCAATAA
AAGAGTTCTCAAGAGGTAATTTAAGAATTGGAGTTCTAAAGCATCAGGGATAAATAAACA
TAAGATAGAAATATAAAACAAAAATTAGGATTATAGCCAAATTTAGATAACATTAGAGTT
TCCAGTAGATTTTAGCTCGATCCTGCTTCATTGAATGTCAGAAGATAAGATGCTTTCAAA
TAGCTTGATATGTTTAGATTCACTAATAATCCAAATTAATTGGAAAACAAATCACAGCAG
GCTATTTCTTAAACTTAATAAATTATTAATATATAAAAAAACTAAAATCTAATAGTCCCC
CCTTAGAATAGGGATCAGAATCAAAGCAACAGAAACAAGGAAATATTAGAAAACTTTTTT
AAAAACGAGAAAAAACCAGCTATTTCTGATCATTTTAACAAAGGGAGGGTAAGAGGATAA
AATAATAAAGCAAATGATGATAATGAATCTGAAAGAAGTGAAGATACTTCTTCTGATGAA
GATGATAGCAATTCAGAAGGTTCAGGTAGCAAGAAAAAAAAGAACCAAAAACTTGAAAAT
GGCTAATATAAAAGAACACAATTTTAAATGGAAAGTCTTCATGCTTAAAGAATTTTGGAA
AAAAGCAGAAAACTTGAAAAAATGCATGAAAAAGAAAAAGAAAGAGAAAAAAAGCTTAGA
GAAAAGTTGATAAATGAGCCATTGAGAAAAAAGAAGGAAGAAGAAGAAAGGAAAAGACAA
GAAAATTCAAAAATACAAAGAGAAAAACAACTTTTGTCTAAAAAAAGATAGTAGATGCAA
GAATTAATTAGATAAAAGTAGCTAGCTGAATTAAAAAAGAAGACTTATTAAGAGTTATGC
ATAAATTAGAAGCCTAAATAATTTATACTACAATCATTAGCAAACGACCTTAGCATACCT
TCAATTCTTAGCGAAGGATAAACATAAAATAATGATAAAAATGATAAAAACGAGCAAAAT
GATAAAAAAGATGAAAGTAATTAACAATAGGGAAAAACTAATGTAGTTGATATGGCAGCA
TATGATAAAGAATTTGAATTTTTATTTGATGAAACTGAAAACCAAGAAGAGAGAAAAAAT
TTTTACAGTCTTATCAAATTTATCTTCTCTCAGGACTACAATAAAGAGGAAATTATCAGA
GTTGAAAACAAAAAAATACCCAACAAATTCAACAGCTGGAAAGAGTATTATACCATATTT
GAATATCTCTTTTTGATGGAATGTATTTCTAACGTTCAATAAGTTTTTTAATCATTTAAA
TCAAACGAAAATTACAGACAGCCGTTTAGCTGTTTTGCTAAGTTGAACAATTTATCTGAT
AACAACCATGGATTTATTGAATTTACTGTATAGAGGTCTTCAGTATTCAAAGACCAAAAG
GAAGATTTAGAAAACGGTGAACTTAATACATCAGAAGATGATTTTTATAGATTATGCACT
CTTAAGAATCATGCTGTTTTGATGTCAAATTCAAGTGAATTAGATTTTACCTAGTTGACT
TAAACTGAATTTAAGAAAAAGAAGTAATTCTTATTCTTTGGTTGGGTTGTACCACCAGAG
TCTAATGGTTAAGATACACTTAAGATTTATGCAGACATTGATGCCCAGGCATTTGTGAAA
TAATTTGTTGGATATGATGGTTCTATTCCAATAAAAATATTTAACTTCTAAAAAATGACC
ACATTCATTAGAGAATATTTGTCTATAAAAAATATGAGATACAATGATATAAATAGATTC
ATATATAATCCTCTGAATATCACACAAAACAATACACCAGTTGCTAATCCATTTTCTTTA
GTTGATTTCTTTGAAGAGTTGAAAAATCGATACAATGATTCTTAATTACAGTCAATTAAA
GAAATTTGCTTAACTAGTTAAGGTATTTGCATGCTTTAAGGCCCACCTGGTACTGGTAAA
ACACATACGCTTTTGGGTCTTCTTGCTGGGCTGTATCACTATATTAAGAAGAATCAAGAT
CATACAAAGCCTAAAATAATGATCTGTGCTCCTTCAAACACTGCAGTAGACGAAATAGTT
TCGAGAATTATTGAACATGACCTTATTGCACCAGGAGGATAAAAGGTCAAGGTAAACGTT
ATACGTATAGGTGCAATAGACTATGTACCTTCTGAAAATGTTAAGAAAGCGTGCTTAGAA
TATTAAATAGAAAGAAAAATGAAAGAAATGAAGATGAATGGTTAAATTAAAAAAGGAGAA
GAAGATACTTTAATAGATATGTAAATCGAAGTTGCAAAAATTAATTAGTAAATTGAAAAA
TCTAAAAAAGAATTAACGGGTTCAGATTTATCTGCAGAACTTGATTTTCTATTTGATAAA
AAGAGAAAGCTTCAATCAAAAATTTCAATTCTAAAACTAGAAAAAGTTGCAAGACGTGAT
CAAATTAAGAATATATCAGACTAGTTATTAGGATTAGCTGATGTTGTATGCTGTACTTTG
GCTAGTTCTATGAGCGAAAAATTAGAGAGATTTAAAAATTAAGTAGAAGTTCTAATAGTG
GACGAAGCAGCTTAATGCACAGAGCCTAACAACATCATTCCCCTTTATTATTAACCAAAC
AAAATGATCTTAATCGGTGATCCTAAACAGTTGCCAGCTACAACTTTCTAACCTGAGAGT
AACATTACGAAGTATAATAGAAGTCTCTTTGAAAGAATCATTGACAATAAGATTAAGCCA
TATTTCTTAGATTAGTAATATAGAATGCATCCTAATATCAGAGAGTTTCCTTCTATTTAA
TTTTACGATAATAAATTAAAAGATGGTCCTTCAGTAGCTAATCGTCCTTTTCCTAATTAT
CTATAAAGATTAGAGAGGTTTAATACTTAATTTATTGATATTGTTTTCAGTAGAGAAAAA
ATGAATTAAAAGTCTTATGAAAATGAAGCTGAAGGTCTGGCTTCTATTTCAATATGTAAT
TAAATTATAGATGAAATCGAAAGATAGTAAAAAGTCTAACCAGAAAGTAAAGAAACTCTT
TCAATAGGTATTATCACTCCTTATAAGCAGTAAACAAGGCTTATTAATGAATTGATTCGC
AAATAAATTCCTAAGTCATACCATAAATTTATTCAAGTTAACACAGTTGATTCTTTCCAA
GGGTAGGAAAAGGATATTATCATTTTTACAACAGTCCGTGTAAACAGTAAACAAGAATGG
AGAGAGAATATGATTGGTTTCTTACAAGATGAAAGAAGAATGAATGTTGCTTTAACAAGA
GCTAAATACTGCTTAATTGTTTTAGGTCACGCAGACACTCTTAATTCCAACCCTGTTTGG
GGAGCCTTTGTAGATTTTATGGCAAAAAATAACAGGTATGGCAAATTTAGAAACAAAGAT
TAGATTAGTGATATCGGTAAAATGGTACTAAAAGGCTCTTTGTTAGAGAGCTCTTCTTCG
GTTTATGTGAAAAAAGATTGGGGAGAGCAATATCAAGAGATGATACAAAGACAAAACTAA
GTTAATGAACTGAAATTGACTGATTTTGAGCCTATACAAGTTGATGAAAATAACGACGAA
GAAAAAATGTAAATAGAAAACGAAATTTAGACGGAATAGTAACCAGAAAATAAGCAAGAT
AATAACAATAAAGAAGGACCTAATGAATAGATTAAATAAGACGCACCTATTGTTAAGTAA
TCATAAGATTTAATAATTATTTCAGAAACTCTAATAGTGGATAAAAAAAATAGCAATTTA
TTAGAAATCATATAAGAACCTGAAGACTTTGATTAATAAAAGCAATAAAAGGCTAAGAGG
ACAGGTATTTCCTTTTAAGAAGCTCTCTCTGTCTAGCAGGAATAAATGCAAATGAATAGC
ATGAAAGGAAATGGCTTAGCTAAATTAAGTGCTTTGATTTCTCAACCTTAAAAGGAGAAG
AAGTAGGAAGAAGAGAAGTCACCAATAATATTTGTTAATAAGCTTGAAGATCTTAAAAAA
GAAGAAGATCCTTAAAATGATTTGCTAAAAAAGATATTTGTGCCACAAGATAAAAGATAA
GAACAAGAACAGAAAAAGAACTTGACCGGTTAATTAGACATTTATGAATAATTAGGATAG
CAAAGAAGAGAAAACATTCAAAAGTTAAAGAAAGAATTTTCTCAATAAGATAAAGATAGT
TTTAAGCTTTAAAATAAATCAGTTTCATCAAATCTAACTCAATAAAAACCTTCTGCTCCA
GCTTCTATGGTCTAACTTGTGTAAAGTGCTTAAAATTAAGTTAAATAAAAATTATAAAAT
TCTAGTTAAACTAACTTGGGTAAGTCTAGTACTTTTACTCCTTCATCTAGCTTGTAAACT
CTTTAATCATTAACTGATAACCAGTCAAATGATTAAAATTCTAAAAAAGGTTTGGGATCT
CTTCTAGGTGGCAACGATGATAAAGAATAATAAAAATCATTTTATAAACCTCAAAAAAGT
AATTAGTAGGAAGATGATATCTATGAGCAGTTAAGGTAGTAGAGAAGAGATAACTCAAAA
AATACTATTAAAGAGCAAAATCATGATAGTAAAAGTAGCTCAAATAATTTTACAAATTAT
ATTCGCAAGCCCTACAATCCAGATTCTGATAAAAATTCATACTCTCCATCAAGTTCCTTA
TAAAACATATCTAAGCAATCACTGAGCTATTAAAATAACAATTTAAAGTACGACTAAAAG
TAAAATAATTAAAAATAAGATTAAGGGGCAGCACCAAGCCAAAATAAGCTTAATTATACT
AGTGGCAGTGCTTTATTGTTAAATAGTATAACTAATTCTAAGCAATAAGTACCTTCTACT
TCTTAAAGTAATTCCAAAACTAAGGGTGGATTAGGAAGCTTAATTTCAAAATGA


>TTHERM_00011340(protein)
MSNYFNSSSNGQKSYQQQQQQRSLSFLSQQIDQNDQQKRGIEYYFSKQKNQNNGVDRMLD
GIKEFQYENKEEDKSQITNHSFKRQGGAQMTLDFFSGALPKNTSHLQNIITSKQNTQNSQ
NHSKSNQNYSIIIDEFERNNNSDDNDDISEVQDIGPFTKRPQAKQQINIEDDDDDIDDSI
EILPEGDLTANNQLKQNGNSLLSSLLSRQQKNNSNNSNNGSIVQRSLMPNQIFMPKHSNS
QENQFGSSKEIFNFQSNSQQKSSQEVIQELEFQSIRDKQTQDRNIKQKLGLQPNLDNIRV
SSRFQLDPASLNVRRQDAFKQLDMFRFTNNPNQLENKSQQAISQTQQIINIQKNQNLIVP
PQNRDQNQSNRNKEILENFFKNEKKPAISDHFNKGRVRGQNNKANDDNESERSEDTSSDE
DDSNSEGSGSKKKKNQKLENGQYKRTQFQMESLHAQRILEKSRKLEKMHEKEKEREKKLR
EKLINEPLRKKKEEEERKRQENSKIQREKQLLSKKRQQMQELIRQKQLAELKKKTYQELC
INQKPKQFILQSLANDLSIPSILSEGQTQNNDKNDKNEQNDKKDESNQQQGKTNVVDMAA
YDKEFEFLFDETENQEERKNFYSLIKFIFSQDYNKEEIIRVENKKIPNKFNSWKEYYTIF
EYLFLMECISNVQQVFQSFKSNENYRQPFSCFAKLNNLSDNNHGFIEFTVQRSSVFKDQK
EDLENGELNTSEDDFYRLCTLKNHAVLMSNSSELDFTQLTQTEFKKKKQFLFFGWVVPPE
SNGQDTLKIYADIDAQAFVKQFVGYDGSIPIKIFNFQKMTTFIREYLSIKNMRYNDINRF
IYNPLNITQNNTPVANPFSLVDFFEELKNRYNDSQLQSIKEICLTSQGICMLQGPPGTGK
THTLLGLLAGLYHYIKKNQDHTKPKIMICAPSNTAVDEIVSRIIEHDLIAPGGQKVKVNV
IRIGAIDYVPSENVKKACLEYQIERKMKEMKMNGQIKKGEEDTLIDMQIEVAKINQQIEK
SKKELTGSDLSAELDFLFDKKRKLQSKISILKLEKVARRDQIKNISDQLLGLADVVCCTL
ASSMSEKLERFKNQVEVLIVDEAAQCTEPNNIIPLYYQPNKMILIGDPKQLPATTFQPES
NITKYNRSLFERIIDNKIKPYFLDQQYRMHPNIREFPSIQFYDNKLKDGPSVANRPFPNY
LQRLERFNTQFIDIVFSREKMNQKSYENEAEGLASISICNQIIDEIERQQKVQPESKETL
SIGIITPYKQQTRLINELIRKQIPKSYHKFIQVNTVDSFQGQEKDIIIFTTVRVNSKQEW
RENMIGFLQDERRMNVALTRAKYCLIVLGHADTLNSNPVWGAFVDFMAKNNRYGKFRNKD
QISDIGKMVLKGSLLESSSSVYVKKDWGEQYQEMIQRQNQVNELKLTDFEPIQVDENNDE
EKMQIENEIQTEQQPENKQDNNNKEGPNEQIKQDAPIVKQSQDLIIISETLIVDKKNSNL
LEIIQEPEDFDQQKQQKAKRTGISFQEALSVQQEQMQMNSMKGNGLAKLSALISQPQKEK
KQEEEKSPIIFVNKLEDLKKEEDPQNDLLKKIFVPQDKRQEQEQKKNLTGQLDIYEQLGQ
QRRENIQKLKKEFSQQDKDSFKLQNKSVSSNLTQQKPSAPASMVQLVQSAQNQVKQKLQN
SSQTNLGKSSTFTPSSSLQTLQSLTDNQSNDQNSKKGLGSLLGGNDDKEQQKSFYKPQKS
NQQEDDIYEQLRQQRRDNSKNTIKEQNHDSKSSSNNFTNYIRKPYNPDSDKNSYSPSSSL
QNISKQSLSYQNNNLKYDQKQNNQKQDQGAAPSQNKLNYTSGSALLLNSITNSKQQVPST
SQSNSKTKGGLGSLISK


>TTHERM_00011340(gene)
ATGAGTAATTATTTTAACTCTTCTTCTAATGGCTAGAAGAGTTATTAATAGTAGTAGCAG
TAGCGTAGCTTATCATTTTTGTCTTAATAGATAGACTAAAATGATTAGTAAAAAAGAGGA
ATTGAATATTATTTTTCAAAGTAAAAAAATTAAAACAATGGCGTTGATAGAATGTTAGAT
GGTATTAAAGAATTTTAGTATGAGAACAAAGAAGAAGATAAAAGTTAAATCACTAATCAT
TCTTTTAAGAGGTAAGGAGGTGCTTAAATGACTTTGGATTTCTTTTCTGGGGCTTTACCA
AAAAATACTTCCCATCTACAAAATATCATAACATCAAAGTAGAATACATAAAATAGTTAG
AATCATAGTAAAAGTAATTAGAACTATAGCATAATTATTGATGAGTTTGAAAGAAACAAC
AATAGCGATGATAATGATGATATTTCAGAAGTTTAAGATATTGGACCATTTACAAAGAGA
CCATAGGCAAAGCAATAAATAAATATAGAAGACGATGATGATGATATTGATGATTCAATA
GAAATATTACCAGAAGGAGATTTAACTGCAAACAATTAATTGAAATAAAATGGAAATAGT
TTACTATCTTCACTTCTTAGTAGGCAATAAAAGAACAATAGTAATAATAGTAATAATGGA
AGTATTGTTTAGAGGAGCTTGATGCCTAATTAGATTTTTATGCCTAAACATTCTAATTCC
TAGGAAAATTAATTTGGCTCTTCTAAAGAAATTTTCAATTTTTAGAGTAATAGTCAATAA
AAGAGTTCTCAAGAGGTAATTTAAGAATTGGAGTTCTAAAGCATCAGGGATAAATAAACA
TAAGATAGAAATATAAAACAAAAATTAGGATTATAGCCAAATTTAGATAACATTAGAGTT
TCCAGTAGATTTTAGCTCGATCCTGCTTCATTGAATGTCAGAAGATAAGATGCTTTCAAA
TAGCTTGATATGTTTAGATTCACTAATAATCCAAATTAATTGGAAAACAAATCACAGCAG
GCTATTTCTTAAACTTAATAAATTATTAATATATAAAAAAACTAAAATCTAATAGTCCCC
CCTTAGAATAGGGATCAGAATCAAAGCAACAGAAACAAGGAAATATTAGAAAACTTTTTT
AAAAACGAGAAAAAACCAGCTATTTCTGATCATTTTAACAAAGGGAGGGTAAGAGGATAA
AATAATAAAGCAAATGATGATAATGAATCTGAAAGAAGTGAAGATACTTCTTCTGATGAA
GATGATAGCAATTCAGAAGGTTCAGGTAGCAAGAAAAAAAAGAACCAAAAACTTGAAAAT
GGCTAATATAAAAGAACACAATTTTAAATGGAAAGTCTTCATGCTTAAAGAATTTTGGAA
AAAAGCAGAAAACTTGAAAAAATGCATGAAAAAGAAAAAGAAAGAGAAAAAAAGCTTAGA
GAAAAGTTGATAAATGAGCCATTGAGAAAAAAGAAGGAAGAAGAAGAAAGGAAAAGACAA
GAAAATTCAAAAATACAAAGAGAAAAACAACTTTTGTCTAAAAAAAGATAGTAGATGCAA
GAATTAATTAGATAAAAGTAGCTAGCTGAATTAAAAAAGAAGACTTATTAAGAGTTATGC
ATAAATTAGAAGCCTAAATAATTTATACTACAATCATTAGCAAACGACCTTAGCATACCT
TCAATTCTTAGCGAAGGATAAACATAAAATAATGATAAAAATGATAAAAACGAGCAAAAT
GATAAAAAAGATGAAAGTAATTAACAATAGGGAAAAACTAATGTAGTTGATATGGCAGCA
TATGATAAAGAATTTGAATTTTTATTTGATGAAACTGAAAACCAAGAAGAGAGAAAAAAT
TTTTACAGTCTTATCAAATTTATCTTCTCTCAGGACTACAATAAAGAGGAAATTATCAGA
GTTGAAAACAAAAAAATACCCAACAAGTAATTAGCTAAATTAATATATAAATAAAATATT
TTTTATGATAAAACAATTTAATAATAATAAAATTTTCTCAATTTAATTAACGGAAAGTAA
AAAATAAATGGTCATTCAAACCGTTAGATTATTTAGTTAGATAGAAATATTTTATTAATG
GGAAATGCCAAAAATTAGTTTTAGGAAACAAACATACAAACAAGCAAACAAATAATTTAA
TAATAATTAAAACTAATTTATAAATTTACAATTTCTAAAACTAAAAGAATTTTTTAAGAT
GTCTTTTAATACAATTTTTACTTTCTTTAAGCAAATAATCATCAGTAATTAATACAACAA
ACAGACAAACAAGCTTAGAAATAAAAAGTTTGAGATCAGATAAAAAGCTATAAAAATAAA
GAATCATTAGTTGATTTTAAAAATAAATTTAGAATTTTTAAGATAAATCTAATTTCGTTT
CAGACATTCTTTCCTTTGAATTATTCTAATTATTTATTTGAATTCTAAGCAGTTTACCAT
ATTTCTCATAAGCTTTCATAAATTTTCCCTCCAATTTGATATTTTTTAAATTTTAATAAA
TCAACCAATTTGCTTTTTATATTAATTGCATCTACCTTTAAACAAAAAAGAAAAACACTT
TTATCATTTAATTAAAATTATTTTTATATTAAAATTGACTAATTATTTGATAAAATATGC
CTACATAGCTTAAAAAGATATTTTTTTTAATTGATAGAATCTATTTAAAATATTTCCTTT
TATTAATAAAATAGATTCAACAGCTGGAAAGAGTATTATACCATATTTGAATATCTCTTT
TTGATGGAATGTATTTCTAACGTTCAATAAGTTTTTTAATCATTTAAATCAAACGAAAAT
TACAGACAGCCGTTTAGCTGTTTTGCTAAGTTGAACAATTTATCTGATAACAACCATGGA
TTTATTGAATTTACTGTATAGAGGTCTTCAGTATTCAAAGACCAAAAGGAAGATTTAGAA
AACGGTGAACTTAATACATCAGAAGATGATTTTTATAGATTATGCACTCTTAAGAATCAT
GCTGTTTTGATGTCAAATTCAAGTGAATTAGATTTTACCTAGTTGACTTAAACTGAATTT
AAGAAAAAGAAGTAATTCTTATTCTTTGGTTGGGTTGTACCACCAGAGTCTAATGGTTAA
GATACACTTAAGATTTATGCAGACATTGATGCCCAGGCATTTGTGAAATAATTTGTTGGA
TATGATGGTTCTATTCCAATAAAAATATTTAACTTCTAAAAAATGACCACATTCATTAGA
GAATATTTGTCTATAAAAAATATGAGATACAATGATATAAATAGATTCATATATAATCCT
CTGAATATCACACAAAACAATACACCAGTTGCTAATCCATGTATAATAAATTTATAAATA
AATAAACTAATTAATTTTTTTAAATTAAATTTATCAATCTTAATGTAAAAAAAGTTTCTT
TAGTTGATTTCTTTGAAGAGTTGAAAAATCGATACAATGATTCTTAATTACAGTCAATTA
AAGAAATTTGCTTAACTAGTTAAGGTATTTGCATGCTTTAAGGCCCAGTAATTTAATAAA
AAATAGCATTTATTTCAATTTCATTTTTTAAATTTTCACATAAAAAATAAAAATTTTTTC
AATTATTTTTATTAATAAATTTGTAATTTAATAGAATTTTTTCTAACTAGATATGTTTTT
TAAATTTATTTTATTGAATAAAGCCTGGTACTGGTAAAACACATACGCTTTTGGGTCTTC
TTGCTGGGCTGTATCACTATATTAAGAAGAATCAAGATCATACAAAGCCTAAAATAATGG
TAATTAAATTGACATTTATAAGTTTGTAAATTTATTTATTTATTAATGATTAGATCTGTG
CTCCTTCAAACACTGCAGTAGACGAAATAGTTTCGAGAATTATTGAACATGACCTTATTG
CACCAGGAGGATAAAAGGTCAAGGTAAACGTTATACGTATAGGTGCAATAGACTATGTGT
AAGTTTTTAAAGATTGAGATTAATAAAATTAATTTTCATTTATTAATTTAGACCTTCTGA
AAATGTTAAGAAAGCGTGCTTAGAATATTAAATAGAAAGAAAAATGAAAGAAATGAAGAT
GAATGGTTAAATTAAAAAAGGAGAAGAAGATACTTTAATAGATATGTAAATCGAAGTTGC
AAAAATTAATTAGTAAATTGAAAAATCTAAAAAAGAATTAACGGGTTCAGATTTATCTGC
AGAACTTGATTTTCTATTTGATAAAAAGAGAAAGCTTCAATCAAAAATTTCAATTCTAAA
ACTAGAAAAAGTTGCAAGACGTGATCAAATTAAGAATATATCAGACTAGTTATTAGGATT
AGCTGATGTAAAATTAATTAATTAATTGATTTTATTTTTTAATTCATTTAAAATTACTAT
ATAGGTTGTATGCTGTACTTTGGCTAGTTCTATGAGCGAAAAATTAGAGAGATTTAAAAA
TTAAGTAGAAGTTCTAATAGTGGACGAAGCAGCTTAAGTAAATTTCTAAATTATCATTTT
TTTTTTGTAAATGAATTGTATAATAAACAGTGCACAGAGCCTAACAACATCATTCCCCTT
TATTATTAACCAAACAAAATGATCTTAATCGGTAATTCTTACTTAATCTCTTCATATACA
TCTCATTATCGATTTTTTTTGTATGTAAGATATTAAATTTATTAAATTTAGGTGATCCTA
AACAGTTGCCAGCTACAACTTTCTAACCTGAGAGTAACATTACGAAGTATAATAGAAGTC
TCTTTGAAAGAATCATTGACAATAAGATTAAGCCATATTTCTTAGATTAGTAATATAGAA
TGCATCCTAATATCAGAGAGTTTCCTTCTATTTAATTTTACGATAATAAGTAAATTAAAT
TATTGTGTCATTCATTCATTCATACATTCATTTAATTTTTTAGCATTTATTTATTTTCAA
CTTTTCGATTTCATTTTTCTTTGAATACTTTTTTTTATGATTTTTGATGAAAATGTATTT
TTATTTTTTAATTTGTTGATATTAAGATTAAAAGATGGTCCTTCAGTAGCTAATCGTCCT
TTTCCTAATTATCTATAAAGATTAGAGAGGTTTAATACTTAATTTATTGATATTGTTTTC
AGTAGAGAAAAAATGAATTAAAAGTCTTATGAAAATGAAGCTGAAGGTCTGGCTTCTATT
TCAATATGTAATTAAATTATAGATGAAATCGAAAGATAGTAAAAAGTCTAACCAGAAAGT
AAAGAAACTCTTTCAATAGGTATTATCACTCCTTATAAGCAGTAAACAAGGCTTATTAAT
GAATTGATTCGCAAATAAATTCCTAAGTCATACCATAAATTTATTCAAGTTAACACAGTT
GATTCTTTCCAAGGGTAGGAAAAGGATATTATCATTTTTACAACAGTCCGTGTAAACAGT
AAACAAGAATGGAGAGAGAATATGATTGGGTAAATAAATAACTAAATACATTTTTTTTAT
TGTAATGTTGGTATTTATTAAATACAAATAAAGTTTCTTACAAGATGAAAGAAGAATGAA
TGTTGCTTTAACAAGAGCTAAATACTGCTTAATTGTTTTAGGTCACGCAGACACTCTTAA
TTCCAACCCTGTTTGGGGAGCCTTTGTAGATTTTATGGTAATTTAGTGATTTATCAGTAT
TTTTTACACAAAAAAAGTTTATTTATAAATTTAAAATGAAATATTTTTCATTTTTTTATC
AAAAAGGCAAAAAATAACAGGTATGGCAAATTTAGAAACAAAGATTAGATTAGTGATATC
GGTAAAATGGTACTAAAAGGCTCTTTGTTAGAGAGCTCTTCTTCGGTTTATGTGAAAAAA
GATTGGGGAGAGCAATATCAAGAGATGATACAAAGACAAAACTAAGTTAATGAACTGAAA
TTGACTGATTTTGAGCCTATACAAGTTGATGAAAATAACGACGAAGAAAAAATGTAAATA
GAAAACGAAATTTAGACGGAATAGTAACCAGAAAATAAGCAAGATAATAACAATAAAGAA
GGACCTAATGAATAGATTAAATAAGACGCACCTATTGTTAAGTAATCATAAGATTTAATA
ATTATTTCAGAAACTCTAATAGTGGATAAAAAAAATAGCAATTTATTAGAAATCATATAA
GAACCTGAAGACTTTGATTAATAAAAGCAATAAAAGGCTAAGAGGACAGGTATTTCCTTT
TAAGAAGCTCTCTCTGTCTAGCAGGAATAAATGCAAATGAATAGCATGAAAGGAAATGGC
TTAGCTAAATTAAGTGCTTTGATTTCTCAACCTTAAAAGGAGAAGAAGTAGGAAGAAGAG
AAGTCACCAATAATATTTGTTAATAAGCTTGAAGATCTTAAAAAAGAAGAAGATCCTTAA
AATGATTTGCTAAAAAAGATATTTGTGCCACAAGATAAAAGATAAGAACAAGAACAGAAA
AAGAACTTGACCGGTTAATTAGACATTTATGAATAATTAGGATAGCAAAGAAGAGAAAAC
ATTCAAAAGTTAAAGAAAGAATTTTCTCAATAAGATAAAGATAGTTTTAAGCTTTAAAAT
AAATCAGTTTCATCAAATCTAACTCAATAAAAACCTTCTGCTCCAGCTTCTATGGTCTAA
CTTGTGTAAAGTGCTTAAAATTAAGTTAAATAAAAATTATAAAATTCTAGTTAAACTAAC
TTGGGTAAGTCTAGTACTTTTACTCCTTCATCTAGCTTGTAAACTCTTTAATCATTAACT
GATAACCAGTCAAATGATTAAAATTCTAAAAAAGGTTTGGGATCTCTTCTAGGTGGCAAC
GATGATAAAGAATAATAAAAATCATTTTATAAACCTCAAAAAAGTAATTAGTAGGAAGAT
GATATCTATGAGCAGTTAAGGTAGTAGAGAAGAGATAACTCAAAAAATACTATTAAAGAG
CAAAATCATGATAGTAAAAGTAGCTCAAATAATTTTACAAATTATATTCGCAAGCCCTAC
AATCCAGATTCTGATAAAAATTCATACTCTCCATCAAGTTCCTTATAAAACATATCTAAG
CAATCACTGAGCTATTAAAATAACAATTTAAAGTACGACTAAAAGTAAAATAATTAAAAA
TAAGATTAAGGGGCAGCACCAAGCCAAAATAAGCTTAATTATACTAGTGGCAGTGCTTTA
TTGTTAAATAGTATAACTAATTCTAAGCAATAAGTACCTTCTACTTCTTAAAGTAATTCC
AAAACTAAGGGTGGATTAGGAAGCTTAATTTCAAAATGA