Identifiers and Description

Gene Model Identifier

TTHERM_00011340

Standard Name

SEN2 (putative helicase SEN2)

Aliases

PreTt11740 | 1.m00788

Description

SEN2 AAA domain protein; putative helicase required for processing of tRNAs- rRNAs- and small nuclear RNAs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00011340

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02812.19.997093137033517e-262hypothetical protein (1812 aa)
OxytrichaContig9372.0.1.g135.001102406662288e-90AAA domain
SGDYLR430W2.9997879492220375e-71SEN1 Presumed helicase require
d for RNA polymerase II transc
ription termination and proces
sing of RNAs; homolog of Senat
axin which causes Ataxia-Oculo
motor Apraxia 2 and a dominant
form of amyotrophic lateral s
clerosis
DictyBaseDDB_G02852434.000989088096131e-71DDB_G0285243 on chromosome: 4
position 2998910 to 3005650
WormBaseWBGene000048805.997992534675281e-52locus:smg-2 Regulator of non
sense transcripts 1 status:C
onfirmed UniProt:O76512 pr
otein_id:CCD73461.1
Stentor CoeruleusSteCoe_144613.3057006267607343e-37

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00011340(coding)
ATGAGTAATTATTTTAACTCTTCTTCTAATGGCTAGAAGAGTTATTAATAGTAGTAGCAG
TAGCGTAGCTTATCATTTTTGTCTTAATAGATAGACTAAAATGATTAGTAAAAAAGAGGA
ATTGAATATTATTTTTCAAAGTAAAAAAATTAAAACAATGGCGTTGATAGAATGTTAGAT
GGTATTAAAGAATTTTAGTATGAGAACAAAGAAGAAGATAAAAGTTAAATCACTAATCAT
TCTTTTAAGAGGTAAGGAGGTGCTTAAATGACTTTGGATTTCTTTTCTGGGGCTTTACCA
AAAAATACTTCCCATCTACAAAATATCATAACATCAAAGTAGAATACATAAAATAGTTAG
AATCATAGTAAAAGTAATTAGAACTATAGCATAATTATTGATGAGTTTGAAAGAAACAAC
AATAGCGATGATAATGATGATATTTCAGAAGTTTAAGATATTGGACCATTTACAAAGAGA
CCATAGGCAAAGCAATAAATAAATATAGAAGACGATGATGATGATATTGATGATTCAATA
GAAATATTACCAGAAGGAGATTTAACTGCAAACAATTAATTGAAATAAAATGGAAATAGT
TTACTATCTTCACTTCTTAGTAGGCAATAAAAGAACAATAGTAATAATAGTAATAATGGA
AGTATTGTTTAGAGGAGCTTGATGCCTAATTAGATTTTTATGCCTAAACATTCTAATTCC
TAGGAAAATTAATTTGGCTCTTCTAAAGAAATTTTCAATTTTTAGAGTAATAGTCAATAA
AAGAGTTCTCAAGAGGTAATTTAAGAATTGGAGTTCTAAAGCATCAGGGATAAATAAACA
TAAGATAGAAATATAAAACAAAAATTAGGATTATAGCCAAATTTAGATAACATTAGAGTT
TCCAGTAGATTTTAGCTCGATCCTGCTTCATTGAATGTCAGAAGATAAGATGCTTTCAAA
TAGCTTGATATGTTTAGATTCACTAATAATCCAAATTAATTGGAAAACAAATCACAGCAG
GCTATTTCTTAAACTTAATAAATTATTAATATATAAAAAAACTAAAATCTAATAGTCCCC
CCTTAGAATAGGGATCAGAATCAAAGCAACAGAAACAAGGAAATATTAGAAAACTTTTTT
AAAAACGAGAAAAAACCAGCTATTTCTGATCATTTTAACAAAGGGAGGGTAAGAGGATAA
AATAATAAAGCAAATGATGATAATGAATCTGAAAGAAGTGAAGATACTTCTTCTGATGAA
GATGATAGCAATTCAGAAGGTTCAGGTAGCAAGAAAAAAAAGAACCAAAAACTTGAAAAT
GGCTAATATAAAAGAACACAATTTTAAATGGAAAGTCTTCATGCTTAAAGAATTTTGGAA
AAAAGCAGAAAACTTGAAAAAATGCATGAAAAAGAAAAAGAAAGAGAAAAAAAGCTTAGA
GAAAAGTTGATAAATGAGCCATTGAGAAAAAAGAAGGAAGAAGAAGAAAGGAAAAGACAA
GAAAATTCAAAAATACAAAGAGAAAAACAACTTTTGTCTAAAAAAAGATAGTAGATGCAA
GAATTAATTAGATAAAAGTAGCTAGCTGAATTAAAAAAGAAGACTTATTAAGAGTTATGC
ATAAATTAGAAGCCTAAATAATTTATACTACAATCATTAGCAAACGACCTTAGCATACCT
TCAATTCTTAGCGAAGGATAAACATAAAATAATGATAAAAATGATAAAAACGAGCAAAAT
GATAAAAAAGATGAAAGTAATTAACAATAGGGAAAAACTAATGTAGTTGATATGGCAGCA
TATGATAAAGAATTTGAATTTTTATTTGATGAAACTGAAAACCAAGAAGAGAGAAAAAAT
TTTTACAGTCTTATCAAATTTATCTTCTCTCAGGACTACAATAAAGAGGAAATTATCAGA
GTTGAAAACAAAAAAATACCCAACAAATTCAACAGCTGGAAAGAGTATTATACCATATTT
GAATATCTCTTTTTGATGGAATGTATTTCTAACGTTCAATAAGTTTTTTAATCATTTAAA
TCAAACGAAAATTACAGACAGCCGTTTAGCTGTTTTGCTAAGTTGAACAATTTATCTGAT
AACAACCATGGATTTATTGAATTTACTGTATAGAGGTCTTCAGTATTCAAAGACCAAAAG
GAAGATTTAGAAAACGGTGAACTTAATACATCAGAAGATGATTTTTATAGATTATGCACT
CTTAAGAATCATGCTGTTTTGATGTCAAATTCAAGTGAATTAGATTTTACCTAGTTGACT
TAAACTGAATTTAAGAAAAAGAAGTAATTCTTATTCTTTGGTTGGGTTGTACCACCAGAG
TCTAATGGTTAAGATACACTTAAGATTTATGCAGACATTGATGCCCAGGCATTTGTGAAA
TAATTTGTTGGATATGATGGTTCTATTCCAATAAAAATATTTAACTTCTAAAAAATGACC
ACATTCATTAGAGAATATTTGTCTATAAAAAATATGAGATACAATGATATAAATAGATTC
ATATATAATCCTCTGAATATCACACAAAACAATACACCAGTTGCTAATCCATTTTCTTTA
GTTGATTTCTTTGAAGAGTTGAAAAATCGATACAATGATTCTTAATTACAGTCAATTAAA
GAAATTTGCTTAACTAGTTAAGGTATTTGCATGCTTTAAGGCCCACCTGGTACTGGTAAA
ACACATACGCTTTTGGGTCTTCTTGCTGGGCTGTATCACTATATTAAGAAGAATCAAGAT
CATACAAAGCCTAAAATAATGATCTGTGCTCCTTCAAACACTGCAGTAGACGAAATAGTT
TCGAGAATTATTGAACATGACCTTATTGCACCAGGAGGATAAAAGGTCAAGGTAAACGTT
ATACGTATAGGTGCAATAGACTATGTACCTTCTGAAAATGTTAAGAAAGCGTGCTTAGAA
TATTAAATAGAAAGAAAAATGAAAGAAATGAAGATGAATGGTTAAATTAAAAAAGGAGAA
GAAGATACTTTAATAGATATGTAAATCGAAGTTGCAAAAATTAATTAGTAAATTGAAAAA
TCTAAAAAAGAATTAACGGGTTCAGATTTATCTGCAGAACTTGATTTTCTATTTGATAAA
AAGAGAAAGCTTCAATCAAAAATTTCAATTCTAAAACTAGAAAAAGTTGCAAGACGTGAT
CAAATTAAGAATATATCAGACTAGTTATTAGGATTAGCTGATGTTGTATGCTGTACTTTG
GCTAGTTCTATGAGCGAAAAATTAGAGAGATTTAAAAATTAAGTAGAAGTTCTAATAGTG
GACGAAGCAGCTTAATGCACAGAGCCTAACAACATCATTCCCCTTTATTATTAACCAAAC
AAAATGATCTTAATCGGTGATCCTAAACAGTTGCCAGCTACAACTTTCTAACCTGAGAGT
AACATTACGAAGTATAATAGAAGTCTCTTTGAAAGAATCATTGACAATAAGATTAAGCCA
TATTTCTTAGATTAGTAATATAGAATGCATCCTAATATCAGAGAGTTTCCTTCTATTTAA
TTTTACGATAATAAATTAAAAGATGGTCCTTCAGTAGCTAATCGTCCTTTTCCTAATTAT
CTATAAAGATTAGAGAGGTTTAATACTTAATTTATTGATATTGTTTTCAGTAGAGAAAAA
ATGAATTAAAAGTCTTATGAAAATGAAGCTGAAGGTCTGGCTTCTATTTCAATATGTAAT
TAAATTATAGATGAAATCGAAAGATAGTAAAAAGTCTAACCAGAAAGTAAAGAAACTCTT
TCAATAGGTATTATCACTCCTTATAAGCAGTAAACAAGGCTTATTAATGAATTGATTCGC
AAATAAATTCCTAAGTCATACCATAAATTTATTCAAGTTAACACAGTTGATTCTTTCCAA
GGGTAGGAAAAGGATATTATCATTTTTACAACAGTCCGTGTAAACAGTAAACAAGAATGG
AGAGAGAATATGATTGGTTTCTTACAAGATGAAAGAAGAATGAATGTTGCTTTAACAAGA
GCTAAATACTGCTTAATTGTTTTAGGTCACGCAGACACTCTTAATTCCAACCCTGTTTGG
GGAGCCTTTGTAGATTTTATGGCAAAAAATAACAGGTATGGCAAATTTAGAAACAAAGAT
TAGATTAGTGATATCGGTAAAATGGTACTAAAAGGCTCTTTGTTAGAGAGCTCTTCTTCG
GTTTATGTGAAAAAAGATTGGGGAGAGCAATATCAAGAGATGATACAAAGACAAAACTAA
GTTAATGAACTGAAATTGACTGATTTTGAGCCTATACAAGTTGATGAAAATAACGACGAA
GAAAAAATGTAAATAGAAAACGAAATTTAGACGGAATAGTAACCAGAAAATAAGCAAGAT
AATAACAATAAAGAAGGACCTAATGAATAGATTAAATAAGACGCACCTATTGTTAAGTAA
TCATAAGATTTAATAATTATTTCAGAAACTCTAATAGTGGATAAAAAAAATAGCAATTTA
TTAGAAATCATATAAGAACCTGAAGACTTTGATTAATAAAAGCAATAAAAGGCTAAGAGG
ACAGGTATTTCCTTTTAAGAAGCTCTCTCTGTCTAGCAGGAATAAATGCAAATGAATAGC
ATGAAAGGAAATGGCTTAGCTAAATTAAGTGCTTTGATTTCTCAACCTTAAAAGGAGAAG
AAGTAGGAAGAAGAGAAGTCACCAATAATATTTGTTAATAAGCTTGAAGATCTTAAAAAA
GAAGAAGATCCTTAAAATGATTTGCTAAAAAAGATATTTGTGCCACAAGATAAAAGATAA
GAACAAGAACAGAAAAAGAACTTGACCGGTTAATTAGACATTTATGAATAATTAGGATAG
CAAAGAAGAGAAAACATTCAAAAGTTAAAGAAAGAATTTTCTCAATAAGATAAAGATAGT
TTTAAGCTTTAAAATAAATCAGTTTCATCAAATCTAACTCAATAAAAACCTTCTGCTCCA
GCTTCTATGGTCTAACTTGTGTAAAGTGCTTAAAATTAAGTTAAATAAAAATTATAAAAT
TCTAGTTAAACTAACTTGGGTAAGTCTAGTACTTTTACTCCTTCATCTAGCTTGTAAACT
CTTTAATCATTAACTGATAACCAGTCAAATGATTAAAATTCTAAAAAAGGTTTGGGATCT
CTTCTAGGTGGCAACGATGATAAAGAATAATAAAAATCATTTTATAAACCTCAAAAAAGT
AATTAGTAGGAAGATGATATCTATGAGCAGTTAAGGTAGTAGAGAAGAGATAACTCAAAA
AATACTATTAAAGAGCAAAATCATGATAGTAAAAGTAGCTCAAATAATTTTACAAATTAT
ATTCGCAAGCCCTACAATCCAGATTCTGATAAAAATTCATACTCTCCATCAAGTTCCTTA
TAAAACATATCTAAGCAATCACTGAGCTATTAAAATAACAATTTAAAGTACGACTAAAAG
TAAAATAATTAAAAATAAGATTAAGGGGCAGCACCAAGCCAAAATAAGCTTAATTATACT
AGTGGCAGTGCTTTATTGTTAAATAGTATAACTAATTCTAAGCAATAAGTACCTTCTACT
TCTTAAAGTAATTCCAAAACTAAGGGTGGATTAGGAAGCTTAATTTCAAAATGA


>TTHERM_00011340(protein)
MSNYFNSSSNGQKSYQQQQQQRSLSFLSQQIDQNDQQKRGIEYYFSKQKNQNNGVDRMLD
GIKEFQYENKEEDKSQITNHSFKRQGGAQMTLDFFSGALPKNTSHLQNIITSKQNTQNSQ
NHSKSNQNYSIIIDEFERNNNSDDNDDISEVQDIGPFTKRPQAKQQINIEDDDDDIDDSI
EILPEGDLTANNQLKQNGNSLLSSLLSRQQKNNSNNSNNGSIVQRSLMPNQIFMPKHSNS
QENQFGSSKEIFNFQSNSQQKSSQEVIQELEFQSIRDKQTQDRNIKQKLGLQPNLDNIRV
SSRFQLDPASLNVRRQDAFKQLDMFRFTNNPNQLENKSQQAISQTQQIINIQKNQNLIVP
PQNRDQNQSNRNKEILENFFKNEKKPAISDHFNKGRVRGQNNKANDDNESERSEDTSSDE
DDSNSEGSGSKKKKNQKLENGQYKRTQFQMESLHAQRILEKSRKLEKMHEKEKEREKKLR
EKLINEPLRKKKEEEERKRQENSKIQREKQLLSKKRQQMQELIRQKQLAELKKKTYQELC
INQKPKQFILQSLANDLSIPSILSEGQTQNNDKNDKNEQNDKKDESNQQQGKTNVVDMAA
YDKEFEFLFDETENQEERKNFYSLIKFIFSQDYNKEEIIRVENKKIPNKFNSWKEYYTIF
EYLFLMECISNVQQVFQSFKSNENYRQPFSCFAKLNNLSDNNHGFIEFTVQRSSVFKDQK
EDLENGELNTSEDDFYRLCTLKNHAVLMSNSSELDFTQLTQTEFKKKKQFLFFGWVVPPE
SNGQDTLKIYADIDAQAFVKQFVGYDGSIPIKIFNFQKMTTFIREYLSIKNMRYNDINRF
IYNPLNITQNNTPVANPFSLVDFFEELKNRYNDSQLQSIKEICLTSQGICMLQGPPGTGK
THTLLGLLAGLYHYIKKNQDHTKPKIMICAPSNTAVDEIVSRIIEHDLIAPGGQKVKVNV
IRIGAIDYVPSENVKKACLEYQIERKMKEMKMNGQIKKGEEDTLIDMQIEVAKINQQIEK
SKKELTGSDLSAELDFLFDKKRKLQSKISILKLEKVARRDQIKNISDQLLGLADVVCCTL
ASSMSEKLERFKNQVEVLIVDEAAQCTEPNNIIPLYYQPNKMILIGDPKQLPATTFQPES
NITKYNRSLFERIIDNKIKPYFLDQQYRMHPNIREFPSIQFYDNKLKDGPSVANRPFPNY
LQRLERFNTQFIDIVFSREKMNQKSYENEAEGLASISICNQIIDEIERQQKVQPESKETL
SIGIITPYKQQTRLINELIRKQIPKSYHKFIQVNTVDSFQGQEKDIIIFTTVRVNSKQEW
RENMIGFLQDERRMNVALTRAKYCLIVLGHADTLNSNPVWGAFVDFMAKNNRYGKFRNKD
QISDIGKMVLKGSLLESSSSVYVKKDWGEQYQEMIQRQNQVNELKLTDFEPIQVDENNDE
EKMQIENEIQTEQQPENKQDNNNKEGPNEQIKQDAPIVKQSQDLIIISETLIVDKKNSNL
LEIIQEPEDFDQQKQQKAKRTGISFQEALSVQQEQMQMNSMKGNGLAKLSALISQPQKEK
KQEEEKSPIIFVNKLEDLKKEEDPQNDLLKKIFVPQDKRQEQEQKKNLTGQLDIYEQLGQ
QRRENIQKLKKEFSQQDKDSFKLQNKSVSSNLTQQKPSAPASMVQLVQSAQNQVKQKLQN
SSQTNLGKSSTFTPSSSLQTLQSLTDNQSNDQNSKKGLGSLLGGNDDKEQQKSFYKPQKS
NQQEDDIYEQLRQQRRDNSKNTIKEQNHDSKSSSNNFTNYIRKPYNPDSDKNSYSPSSSL
QNISKQSLSYQNNNLKYDQKQNNQKQDQGAAPSQNKLNYTSGSALLLNSITNSKQQVPST
SQSNSKTKGGLGSLISK


>TTHERM_00011340(gene)
ATGAGTAATTATTTTAACTCTTCTTCTAATGGCTAGAAGAGTTATTAATAGTAGTAGCAG
TAGCGTAGCTTATCATTTTTGTCTTAATAGATAGACTAAAATGATTAGTAAAAAAGAGGA
ATTGAATATTATTTTTCAAAGTAAAAAAATTAAAACAATGGCGTTGATAGAATGTTAGAT
GGTATTAAAGAATTTTAGTATGAGAACAAAGAAGAAGATAAAAGTTAAATCACTAATCAT
TCTTTTAAGAGGTAAGGAGGTGCTTAAATGACTTTGGATTTCTTTTCTGGGGCTTTACCA
AAAAATACTTCCCATCTACAAAATATCATAACATCAAAGTAGAATACATAAAATAGTTAG
AATCATAGTAAAAGTAATTAGAACTATAGCATAATTATTGATGAGTTTGAAAGAAACAAC
AATAGCGATGATAATGATGATATTTCAGAAGTTTAAGATATTGGACCATTTACAAAGAGA
CCATAGGCAAAGCAATAAATAAATATAGAAGACGATGATGATGATATTGATGATTCAATA
GAAATATTACCAGAAGGAGATTTAACTGCAAACAATTAATTGAAATAAAATGGAAATAGT
TTACTATCTTCACTTCTTAGTAGGCAATAAAAGAACAATAGTAATAATAGTAATAATGGA
AGTATTGTTTAGAGGAGCTTGATGCCTAATTAGATTTTTATGCCTAAACATTCTAATTCC
TAGGAAAATTAATTTGGCTCTTCTAAAGAAATTTTCAATTTTTAGAGTAATAGTCAATAA
AAGAGTTCTCAAGAGGTAATTTAAGAATTGGAGTTCTAAAGCATCAGGGATAAATAAACA
TAAGATAGAAATATAAAACAAAAATTAGGATTATAGCCAAATTTAGATAACATTAGAGTT
TCCAGTAGATTTTAGCTCGATCCTGCTTCATTGAATGTCAGAAGATAAGATGCTTTCAAA
TAGCTTGATATGTTTAGATTCACTAATAATCCAAATTAATTGGAAAACAAATCACAGCAG
GCTATTTCTTAAACTTAATAAATTATTAATATATAAAAAAACTAAAATCTAATAGTCCCC
CCTTAGAATAGGGATCAGAATCAAAGCAACAGAAACAAGGAAATATTAGAAAACTTTTTT
AAAAACGAGAAAAAACCAGCTATTTCTGATCATTTTAACAAAGGGAGGGTAAGAGGATAA
AATAATAAAGCAAATGATGATAATGAATCTGAAAGAAGTGAAGATACTTCTTCTGATGAA
GATGATAGCAATTCAGAAGGTTCAGGTAGCAAGAAAAAAAAGAACCAAAAACTTGAAAAT
GGCTAATATAAAAGAACACAATTTTAAATGGAAAGTCTTCATGCTTAAAGAATTTTGGAA
AAAAGCAGAAAACTTGAAAAAATGCATGAAAAAGAAAAAGAAAGAGAAAAAAAGCTTAGA
GAAAAGTTGATAAATGAGCCATTGAGAAAAAAGAAGGAAGAAGAAGAAAGGAAAAGACAA
GAAAATTCAAAAATACAAAGAGAAAAACAACTTTTGTCTAAAAAAAGATAGTAGATGCAA
GAATTAATTAGATAAAAGTAGCTAGCTGAATTAAAAAAGAAGACTTATTAAGAGTTATGC
ATAAATTAGAAGCCTAAATAATTTATACTACAATCATTAGCAAACGACCTTAGCATACCT
TCAATTCTTAGCGAAGGATAAACATAAAATAATGATAAAAATGATAAAAACGAGCAAAAT
GATAAAAAAGATGAAAGTAATTAACAATAGGGAAAAACTAATGTAGTTGATATGGCAGCA
TATGATAAAGAATTTGAATTTTTATTTGATGAAACTGAAAACCAAGAAGAGAGAAAAAAT
TTTTACAGTCTTATCAAATTTATCTTCTCTCAGGACTACAATAAAGAGGAAATTATCAGA
GTTGAAAACAAAAAAATACCCAACAAGTAATTAGCTAAATTAATATATAAATAAAATATT
TTTTATGATAAAACAATTTAATAATAATAAAATTTTCTCAATTTAATTAACGGAAAGTAA
AAAATAAATGGTCATTCAAACCGTTAGATTATTTAGTTAGATAGAAATATTTTATTAATG
GGAAATGCCAAAAATTAGTTTTAGGAAACAAACATACAAACAAGCAAACAAATAATTTAA
TAATAATTAAAACTAATTTATAAATTTACAATTTCTAAAACTAAAAGAATTTTTTAAGAT
GTCTTTTAATACAATTTTTACTTTCTTTAAGCAAATAATCATCAGTAATTAATACAACAA
ACAGACAAACAAGCTTAGAAATAAAAAGTTTGAGATCAGATAAAAAGCTATAAAAATAAA
GAATCATTAGTTGATTTTAAAAATAAATTTAGAATTTTTAAGATAAATCTAATTTCGTTT
CAGACATTCTTTCCTTTGAATTATTCTAATTATTTATTTGAATTCTAAGCAGTTTACCAT
ATTTCTCATAAGCTTTCATAAATTTTCCCTCCAATTTGATATTTTTTAAATTTTAATAAA
TCAACCAATTTGCTTTTTATATTAATTGCATCTACCTTTAAACAAAAAAGAAAAACACTT
TTATCATTTAATTAAAATTATTTTTATATTAAAATTGACTAATTATTTGATAAAATATGC
CTACATAGCTTAAAAAGATATTTTTTTTAATTGATAGAATCTATTTAAAATATTTCCTTT
TATTAATAAAATAGATTCAACAGCTGGAAAGAGTATTATACCATATTTGAATATCTCTTT
TTGATGGAATGTATTTCTAACGTTCAATAAGTTTTTTAATCATTTAAATCAAACGAAAAT
TACAGACAGCCGTTTAGCTGTTTTGCTAAGTTGAACAATTTATCTGATAACAACCATGGA
TTTATTGAATTTACTGTATAGAGGTCTTCAGTATTCAAAGACCAAAAGGAAGATTTAGAA
AACGGTGAACTTAATACATCAGAAGATGATTTTTATAGATTATGCACTCTTAAGAATCAT
GCTGTTTTGATGTCAAATTCAAGTGAATTAGATTTTACCTAGTTGACTTAAACTGAATTT
AAGAAAAAGAAGTAATTCTTATTCTTTGGTTGGGTTGTACCACCAGAGTCTAATGGTTAA
GATACACTTAAGATTTATGCAGACATTGATGCCCAGGCATTTGTGAAATAATTTGTTGGA
TATGATGGTTCTATTCCAATAAAAATATTTAACTTCTAAAAAATGACCACATTCATTAGA
GAATATTTGTCTATAAAAAATATGAGATACAATGATATAAATAGATTCATATATAATCCT
CTGAATATCACACAAAACAATACACCAGTTGCTAATCCATGTATAATAAATTTATAAATA
AATAAACTAATTAATTTTTTTAAATTAAATTTATCAATCTTAATGTAAAAAAAGTTTCTT
TAGTTGATTTCTTTGAAGAGTTGAAAAATCGATACAATGATTCTTAATTACAGTCAATTA
AAGAAATTTGCTTAACTAGTTAAGGTATTTGCATGCTTTAAGGCCCAGTAATTTAATAAA
AAATAGCATTTATTTCAATTTCATTTTTTAAATTTTCACATAAAAAATAAAAATTTTTTC
AATTATTTTTATTAATAAATTTGTAATTTAATAGAATTTTTTCTAACTAGATATGTTTTT
TAAATTTATTTTATTGAATAAAGCCTGGTACTGGTAAAACACATACGCTTTTGGGTCTTC
TTGCTGGGCTGTATCACTATATTAAGAAGAATCAAGATCATACAAAGCCTAAAATAATGG
TAATTAAATTGACATTTATAAGTTTGTAAATTTATTTATTTATTAATGATTAGATCTGTG
CTCCTTCAAACACTGCAGTAGACGAAATAGTTTCGAGAATTATTGAACATGACCTTATTG
CACCAGGAGGATAAAAGGTCAAGGTAAACGTTATACGTATAGGTGCAATAGACTATGTGT
AAGTTTTTAAAGATTGAGATTAATAAAATTAATTTTCATTTATTAATTTAGACCTTCTGA
AAATGTTAAGAAAGCGTGCTTAGAATATTAAATAGAAAGAAAAATGAAAGAAATGAAGAT
GAATGGTTAAATTAAAAAAGGAGAAGAAGATACTTTAATAGATATGTAAATCGAAGTTGC
AAAAATTAATTAGTAAATTGAAAAATCTAAAAAAGAATTAACGGGTTCAGATTTATCTGC
AGAACTTGATTTTCTATTTGATAAAAAGAGAAAGCTTCAATCAAAAATTTCAATTCTAAA
ACTAGAAAAAGTTGCAAGACGTGATCAAATTAAGAATATATCAGACTAGTTATTAGGATT
AGCTGATGTAAAATTAATTAATTAATTGATTTTATTTTTTAATTCATTTAAAATTACTAT
ATAGGTTGTATGCTGTACTTTGGCTAGTTCTATGAGCGAAAAATTAGAGAGATTTAAAAA
TTAAGTAGAAGTTCTAATAGTGGACGAAGCAGCTTAAGTAAATTTCTAAATTATCATTTT
TTTTTTGTAAATGAATTGTATAATAAACAGTGCACAGAGCCTAACAACATCATTCCCCTT
TATTATTAACCAAACAAAATGATCTTAATCGGTAATTCTTACTTAATCTCTTCATATACA
TCTCATTATCGATTTTTTTTGTATGTAAGATATTAAATTTATTAAATTTAGGTGATCCTA
AACAGTTGCCAGCTACAACTTTCTAACCTGAGAGTAACATTACGAAGTATAATAGAAGTC
TCTTTGAAAGAATCATTGACAATAAGATTAAGCCATATTTCTTAGATTAGTAATATAGAA
TGCATCCTAATATCAGAGAGTTTCCTTCTATTTAATTTTACGATAATAAGTAAATTAAAT
TATTGTGTCATTCATTCATTCATACATTCATTTAATTTTTTAGCATTTATTTATTTTCAA
CTTTTCGATTTCATTTTTCTTTGAATACTTTTTTTTATGATTTTTGATGAAAATGTATTT
TTATTTTTTAATTTGTTGATATTAAGATTAAAAGATGGTCCTTCAGTAGCTAATCGTCCT
TTTCCTAATTATCTATAAAGATTAGAGAGGTTTAATACTTAATTTATTGATATTGTTTTC
AGTAGAGAAAAAATGAATTAAAAGTCTTATGAAAATGAAGCTGAAGGTCTGGCTTCTATT
TCAATATGTAATTAAATTATAGATGAAATCGAAAGATAGTAAAAAGTCTAACCAGAAAGT
AAAGAAACTCTTTCAATAGGTATTATCACTCCTTATAAGCAGTAAACAAGGCTTATTAAT
GAATTGATTCGCAAATAAATTCCTAAGTCATACCATAAATTTATTCAAGTTAACACAGTT
GATTCTTTCCAAGGGTAGGAAAAGGATATTATCATTTTTACAACAGTCCGTGTAAACAGT
AAACAAGAATGGAGAGAGAATATGATTGGGTAAATAAATAACTAAATACATTTTTTTTAT
TGTAATGTTGGTATTTATTAAATACAAATAAAGTTTCTTACAAGATGAAAGAAGAATGAA
TGTTGCTTTAACAAGAGCTAAATACTGCTTAATTGTTTTAGGTCACGCAGACACTCTTAA
TTCCAACCCTGTTTGGGGAGCCTTTGTAGATTTTATGGTAATTTAGTGATTTATCAGTAT
TTTTTACACAAAAAAAGTTTATTTATAAATTTAAAATGAAATATTTTTCATTTTTTTATC
AAAAAGGCAAAAAATAACAGGTATGGCAAATTTAGAAACAAAGATTAGATTAGTGATATC
GGTAAAATGGTACTAAAAGGCTCTTTGTTAGAGAGCTCTTCTTCGGTTTATGTGAAAAAA
GATTGGGGAGAGCAATATCAAGAGATGATACAAAGACAAAACTAAGTTAATGAACTGAAA
TTGACTGATTTTGAGCCTATACAAGTTGATGAAAATAACGACGAAGAAAAAATGTAAATA
GAAAACGAAATTTAGACGGAATAGTAACCAGAAAATAAGCAAGATAATAACAATAAAGAA
GGACCTAATGAATAGATTAAATAAGACGCACCTATTGTTAAGTAATCATAAGATTTAATA
ATTATTTCAGAAACTCTAATAGTGGATAAAAAAAATAGCAATTTATTAGAAATCATATAA
GAACCTGAAGACTTTGATTAATAAAAGCAATAAAAGGCTAAGAGGACAGGTATTTCCTTT
TAAGAAGCTCTCTCTGTCTAGCAGGAATAAATGCAAATGAATAGCATGAAAGGAAATGGC
TTAGCTAAATTAAGTGCTTTGATTTCTCAACCTTAAAAGGAGAAGAAGTAGGAAGAAGAG
AAGTCACCAATAATATTTGTTAATAAGCTTGAAGATCTTAAAAAAGAAGAAGATCCTTAA
AATGATTTGCTAAAAAAGATATTTGTGCCACAAGATAAAAGATAAGAACAAGAACAGAAA
AAGAACTTGACCGGTTAATTAGACATTTATGAATAATTAGGATAGCAAAGAAGAGAAAAC
ATTCAAAAGTTAAAGAAAGAATTTTCTCAATAAGATAAAGATAGTTTTAAGCTTTAAAAT
AAATCAGTTTCATCAAATCTAACTCAATAAAAACCTTCTGCTCCAGCTTCTATGGTCTAA
CTTGTGTAAAGTGCTTAAAATTAAGTTAAATAAAAATTATAAAATTCTAGTTAAACTAAC
TTGGGTAAGTCTAGTACTTTTACTCCTTCATCTAGCTTGTAAACTCTTTAATCATTAACT
GATAACCAGTCAAATGATTAAAATTCTAAAAAAGGTTTGGGATCTCTTCTAGGTGGCAAC
GATGATAAAGAATAATAAAAATCATTTTATAAACCTCAAAAAAGTAATTAGTAGGAAGAT
GATATCTATGAGCAGTTAAGGTAGTAGAGAAGAGATAACTCAAAAAATACTATTAAAGAG
CAAAATCATGATAGTAAAAGTAGCTCAAATAATTTTACAAATTATATTCGCAAGCCCTAC
AATCCAGATTCTGATAAAAATTCATACTCTCCATCAAGTTCCTTATAAAACATATCTAAG
CAATCACTGAGCTATTAAAATAACAATTTAAAGTACGACTAAAAGTAAAATAATTAAAAA
TAAGATTAAGGGGCAGCACCAAGCCAAAATAAGCTTAATTATACTAGTGGCAGTGCTTTA
TTGTTAAATAGTATAACTAATTCTAAGCAATAAGTACCTTCTACTTCTTAAAGTAATTCC
AAAACTAAGGGTGGATTAGGAAGCTTAATTTCAAAATGA