Identifiers and Description

Gene Model Identifier

TTHERM_00189400

Standard Name

SEN1 (putative helicase SEN1)

Aliases

PreTt08690 | 15.m00401 | 3697.m00113

Description

putative helicase required for processing of tRNAs, rRNAs, and small nuclear RNAs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00189400

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06264.19.997093137033517e-262hypothetical protein (822 aa)
DictyBaseDDB_G02743994.001158060863534e-95DDB_G0274399 on chromosome: 2
position 4681340 to 4684368
OxytrichaContig9372.0.1.g139.996907204735647e-62AAA domain
SGDYLR430W3.0014802379878627e-60SEN1 Presumed helicase require
d for RNA polymerase II transc
ription termination and proces
sing of RNAs; homolog of Senat
axin which causes Ataxia-Oculo
motor Apraxia 2 and a dominant
form of amyotrophic lateral s
clerosis
WormBaseWBGene000048805.997865882830678e-40locus:smg-2 Regulator of non
sense transcripts 1 status:C
onfirmed UniProt:O76512 pr
otein_id:CCD73461.1
Stentor CoeruleusSteCoe_144611.185064864233981e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00189400(coding)
ATGAGTAATTAGAATCCTAAAGAAGAGATAGAAAAAAAGGATAACAGAATCTTAGATGGT
CTTCATTATTATTTGTGCTCTAGGGATTATAACATTAATTTTGATGAATCTATTGACAAC
ATTAATTTAAATGTAGAAGGAGATGATGAGAATAAAAATAGTGATTTAAATAATATAATT
CCAGAGGAAACTGCTGATAAAAATGCAGATTAAGTTGAATAATAAAATACTTTATAGTAG
CCTTAGATGAGTTTTACAAATTTGGCAAATATTCCATTATCTTTTAACGACCCAGAAGAT
TATGTTAAAACATTTGAATAACATCTCTTTTCTGAAGCAAAAGCATAAATTATCAAAGCC
CAAGTTACAGAATCAAGAGCTCCTGAAATTATGAGATTAAAAAACTCTTAGGTAATTGCT
CTAAAAAATAATTCAGAGCTTTTCTTCAGAAAGCTAACTATGGAGAAAGTTGCTGACTCA
GAAACAAAATATGGAACTCATGATTTTATAGTTATATCATTACAAGATCCTTCCAAAGTA
ATATCAGGAGAACATATGTTAGGTGTAGTAGAAAGAGCTGAAGGAAATGAAATTTTAGTC
AAAGTAGTTTTTGATGAAAATAGCAGCGACCCACGTAATTAAAAAATACTTAAAGTCATG
TAACAAGATGAAAGCGTTTGGAGAAATTGGTATGTGAAAAAGTTTTGCAGTATAGTTACT
ATTCAAAGAGAATACGAAGCTCTACACAATTTTAATGATTTGCTTTTAAAAGAGTTCATA
CTTAATCCTGAAAAGTTAACTCAGAAGAAAGAAGAGAAGTTTTCTATCCCTGAATAGCTT
TCAATTCGTTTAAATTAGATTTATAATCCCTCCCAAATTCAAGCTATTAACTCAACACTA
AAGAAATAAGGTGTTACTTTAATTTAAGGTCCTCCTGGTACAGGTAAAACACGTACTGTG
CTAGGTACTGTTTCAGTGCTTATTAATTCATTTAATGAAGACTAGCTTAAGTAAAAGCAC
TCTATGGAGATTGAAGATAAATCAAAGTTAGTTGAGCAGTCAGGCGAATTCCATTTCGAA
TTAGCTATGCCATGGATGTAGCCTAATTATGTTGATTGGAGAGATAGTACTTTTGATCAC
TTGCATAATGATTTTTCTAATTTTACTAAAACAAAAAAATATATCACTGCTGATTAAACT
GATAAAGTCATTCCTATCCTAAAAGCTTAGGAAGAGCATGCACCCCCTGAAAAAATTTTA
ATTTGTGGTCCTTCAAATGCAGCTATAGATGAAATCGTTCGTAAAATGAAAAAAGAAGGT
TTATTGGACAAAAATGGTAATATTTATGATCCTTCTAAAATTATAGTCAGAATTGGTGAG
AATTATGATAAAGATTTGGAGGATGTATCTTTAGATTATTTAGTCAAGTAAAAACTTGGC
GAATAAAATATCAGATCAGAAGATGCTTAAGAAATAAGAAAGAAAATATTAAAAGAAGCC
AAGATTATCTGTGGTACTCTCAGTTCAACTGGTTCATAAATTTTAGCATCTGCTAACTTT
AAATTTGATACTGTCGTAATTGATGAAGCTGCTCAGTCTACAGAAATAAGTACTCTCATT
CCTTTGCAATATTAATGTACTAGACTTATTTTAATTGGTGATCATAATTAATTGCCTGCT
ACTATATTCTCTAAAAAATGTGAAAAGTTTAATTATCATTAGAGTTTATTCGAACGTTTT
GAAAAATGTAAAGTTGAAGTTCATATGTTAAATTAACAATATAGAATGAACCCCATTATT
AGTAAGTTTATTTCTTAAACTTTTTACTAAGACAAAATTTCAGATGCCGAAAAAATTAAC
GAGCTTGTAGGTTAACCTGAAATTTATTAGTTAAGACTATTTTAGCCTGTCGTTTTCTTT
AACGTTGAAGGTAATGAAATATTTGAAAAATCTTCATATAAGAACGAGGAAGAGTCAAAA
GCTATTGTTGAAATTTATAATAAATTGAGAACTACCTTCCCTAATTTCGATTTGAATAAG
TTAGGTATTATTACTGCTTACTCTCGTTAAGTTAAGGAAATAGAAAAAAAAATTAAAGCT
CACGATAAAACAGACAAGTGTATGGTTGAAGTACACACAGTTGATGGTTTCTAAGGTAGA
GAAAAGGATATAATTATATTCTCTACTGTGAGAGCTAGTTAGGTAAATGGAGAAAAAAAT
ACTAAAAAAACTATTGGTTTCTTAAATGACAGAAGAAGAATGAATGTCAGTTTAAGTAGA
GCAAGATTATGTGTTATAGTTGTGGGTGATCTCAAATAACTTAAATTTTCTAAATTATGG
AAAGGATTAGCAGAATATTCAATAGAATAAAGAAGTTGTTATAATATGGTTGCCCCATAT
TAAACTTTTGTTAGTAAATTAGAATTACACTTTGATTAATACAAAGTTTATAGGGCAACA
TAGAATTGA


>TTHERM_00189400(protein)
MSNQNPKEEIEKKDNRILDGLHYYLCSRDYNINFDESIDNINLNVEGDDENKNSDLNNII
PEETADKNADQVEQQNTLQQPQMSFTNLANIPLSFNDPEDYVKTFEQHLFSEAKAQIIKA
QVTESRAPEIMRLKNSQVIALKNNSELFFRKLTMEKVADSETKYGTHDFIVISLQDPSKV
ISGEHMLGVVERAEGNEILVKVVFDENSSDPRNQKILKVMQQDESVWRNWYVKKFCSIVT
IQREYEALHNFNDLLLKEFILNPEKLTQKKEEKFSIPEQLSIRLNQIYNPSQIQAINSTL
KKQGVTLIQGPPGTGKTRTVLGTVSVLINSFNEDQLKQKHSMEIEDKSKLVEQSGEFHFE
LAMPWMQPNYVDWRDSTFDHLHNDFSNFTKTKKYITADQTDKVIPILKAQEEHAPPEKIL
ICGPSNAAIDEIVRKMKKEGLLDKNGNIYDPSKIIVRIGENYDKDLEDVSLDYLVKQKLG
EQNIRSEDAQEIRKKILKEAKIICGTLSSTGSQILASANFKFDTVVIDEAAQSTEISTLI
PLQYQCTRLILIGDHNQLPATIFSKKCEKFNYHQSLFERFEKCKVEVHMLNQQYRMNPII
SKFISQTFYQDKISDAEKINELVGQPEIYQLRLFQPVVFFNVEGNEIFEKSSYKNEEESK
AIVEIYNKLRTTFPNFDLNKLGIITAYSRQVKEIEKKIKAHDKTDKCMVEVHTVDGFQGR
EKDIIIFSTVRASQVNGEKNTKKTIGFLNDRRRMNVSLSRARLCVIVVGDLKQLKFSKLW
KGLAEYSIEQRSCYNMVAPYQTFVSKLELHFDQYKVYRATQN


>TTHERM_00189400(gene)
ATGAGTAATTAGAATCCTAAAGAAGAGATAGAAAAAAAGGATAACAGAATCTTAGATGGT
CTTCATTATTATTTGTGCTCTAGGGATTATAACATTAATTTTGATGAATCTATTGACAAC
ATTAATTTAAATGTAGAAGGAGATGATGAGAATAAAAATAGTGATTTAAATAATATAATT
CCAGAGGAAACTGCTGATAAAAATGCAGATTAAGTTGAATAATAAAATACTTTATAGTAG
CCTTAGATGAGTTTTACAAATTTGGCAAATATTCCATTATCTTTTAACGACCCAGAAGAT
TATGTTAAAACATTTGAATAACATCTCTTTTCTGAAGCAAAAGCATAAATTATCAAAGCC
CAAGTTACAGAAGTAAGTTTACTACAATTAAACAATATAGATTTGTTTTAAAATAAATAT
AAAATGTTTAAAAAAGTCAAGAGCTCCTGAAATTATGAGATTAAAAAACTCTTAGGTAAT
TGCTCTAAAAAATAATTCAGAGCTTTTCTTCAGAAAGCTAACTATGGAGAAAGTTGCTGA
CTCAGAAACAAAATATGGAACTCATGATTTTATAGTTATATCATTACAAGATGTAAATCA
AATATTTTATTTCTACATAAATTGCAATCAATTTAAGATTAAAAATTTAATTGATTGTTG
AATTTTAAAATATATTTTATTTTTAATCAATAAAGCCTTCCAAAGTAATATCAGGAGAAC
ATATGTTAGGTGTAGTAGAAAGAGCTGAAGGAAATGAAATTTTAGTCAAAGTAGTTTTTG
ATGAAAATAGCAGCGACCCACGTAATTAAAAAATACTTAAAGTCATGTAACAAGATGAAA
GCGTTTGGAGAAATTGGTATGTGAAAAAGTTTTGCAGTATAGTTACTATTCAAAGAGAAT
ACGAAGTAAATTACTTTATTATATATTTATTTGTCTATTAGTCTTGGATATTTGTGGCAA
AGTTTTATGATTTGATTTCGAAGTTATTAAAACTATTTTTATTATCGTAAAGGCTCTACA
CAATTTTAATGATTTGCTTTTAAAAGAGTTCATACTTAATCCTGAAAAGTTAACTCAGAA
GAAAGAAGAGAAGTTTTCTATCCCTGAATAGCTTTCAATTCGTTTAAATTAGATTTATAA
TCCCTCCCAAATTCAAGCTATTAACTCAACACTAAAGAAATAAGGTGTTACTTTAATTTA
AGGTCCTCCTGGTACAGGTAAAACACGTACTGTGCTAGGTACTGTTTCAGTGCTTATTAA
TTCATTTAATGAAGACTAGCTTAAGTAAAAGCACTCTATGGAGATTGAAGATAAATCAAA
GTTAGTTGAGCAGTCAGGCGAATTCCATTTCGAATTGTAATATTTTATTCTAATTTTGTC
TTTAAAAACTAATTAAAATTTTTAAAAATTAGAGCTATGCCATGGATGTAGCCTAATTAT
GTTGATTGGAGAGATAGTACTTTTGATCACTTGCATAATGATTTTTCTAATTTTACTAAA
ACAAAAAAATATATCACTGCTGATTAAACTGATAAAGTCATTCCTATCCTAAAAGCTTAG
GAAGAGCATGCACCCCCTGAAAAAATTTTAATTTGTGGTCCTTCAAATGCAGCTATAGAT
GAAATCGTTCGTAAAATGAAAAAAGAAGTAAAATAAAATATTTTTTATAAATGCCAAATA
TTCATTTATTTCAGAAATTTCATTATTTTTATATATTTTATTTATTCAAAAGGGTTTATT
GGACAAAAATGGTAATATTTATGATCCTTCTAAAATTATAGTCAGAATTGGTGAGAATTA
TGATAAAGATTTGGAGGATGTATCTTTAGATTATTTAGTCAAGTAAAAACTTGGCGAATA
AAATATCAGATCAGAAGATGCTTAAGAAATAAGAAAGAAAATATTAAAAGAAGCCAAGAT
TATCTGTGGTACTCTCAGTTCAACTGGTTCATAAATTTTAGCATCTGCTAACTTTGTAAA
TTAAAAAATAAATAATTCAACTATTTTGATTTAAATAATATGTTTATTTTCATCAAGAAA
TTTGATACTGTCGTAATTGATGAAGCTGCTCAGTCTACAGAAATAAGTACTCTCATTCCT
TTGCAATATTAATGTACTAGACTTATTTTAATTGGTGATCATAATTAATTGCCTGCTACT
ATATTCTCTAAAAAATGTGAAAAGTTTAATTATCATTAGAGTTTATTCGAACGTTTTGAA
AAATGTAAAGTTGAAGTTCATATGTTAAATGTAATAATTTATTTATATCCCATTTTGAGT
TTTAATTTAATAATATTTTTAGTAACAATATAGAATGAACCCCATTATTAGTAAGTTTAT
TTCTTAAACTTTTTACTAAGACAAAATTTCAGATGCCGAAAAAATTAACGAGCTTGTAGG
TTAACCTGAAATTTATTAGTTAAGACTATTTTAGCCTGTCGTTTTCTTTAACGTTGAAGT
AATTTTTTATATATAAATTAAGATAGGTTAAATTAAAAATCAATTAAAAATTATAGGGTA
ATGAAATATTTGAAAAATCTTCATATAAGAACGAGGAAGAGTCAAAAGCTATTGTTGAAA
TTTATAATAAATTGAGAACTACCTTCCCTAATTTCGATTTGAATAAGTTAGGTATTATTA
CTGCTTACTCTCGTTAAGTTAAGGAAATAGAAAAAAAAATTAAAGCTCACGATAAAACAG
ACAAGTGTATGGTTGAAGTACACACAGTTGATGGTTTCTAAGGTAGAGAAAAGGATATAA
TTATATTCTCTACTGTGAGAGCTAGTTAGGTAAATGGAGAAAAAAATACTAAAAAAACTA
TTGGTTTCTTAAATGACAGAAGAAGAATGAATGTCAGTTTAAGTAGAGCAAGATTATGTG
TTATAGTTGTGGGTGATCTCAAATAACTTAAATTTTCTAAATTATGGAAAGGATTAGCAG
AATATTCAATAGAATAAAGAAGTTGTTATAATATGGTTGCCCCATATTAAACTTTTGTTA
GTAAATTAGAATTACACTTTGATTAATACAAAGTTTATAGGGCAACATAGAATTGA