Identifiers and Description

Gene Model Identifier

TTHERM_00954180

Standard Name

SEH1 (nucleoporin Seh1)

Aliases

PreTt04994 | 176.m00067 | Seh1

Description

Nucleoporin common to both MAC and MIC NPCs

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00954180

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13504.19.997093137033517e-262hypothetical protein (369 aa)
OxytrichaContig17748.0.g44.001118334825066e-42WD domain, G-beta repeat
DictyBaseDDB_G02772573.000619078166531e-39DDB_G0277257 on chromosome: 2
position 7833225 to 7834846
WormBaseWBGene000038043.99801309251602e-27locus:npp-18 Nucleoporin SEH
1 status:Confirmed UniProt
:O45933 protein_id:CAA16333.
1
SGDYLR208W5.00179831534194e-27SEC13 Component of the Nup84 n
uclear pore sub-complex, the S
ec13p-Sec31p complex of the CO
PII vesicle coat, and the SEA
(Seh1-associated) complex; req
uired for vesicle formation in
ER to Golgi transport and nuc
lear pore complex organization
; the Nup84 subcomplex has a r
ole in transcription elongatio
n

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:25788697: Iwamoto M, Koujin T, Osakada H, Mori C, Kojidani T, Matsuda A, Asakawa H, Hiraoka Y, Haraguchi T (2015) Biased assembly of the nuclear pore complex is required for somatic and germline nuclear differentiation in Tetrahymena. Journal of cell science 128(9):1812-23
  2. Ref:19375312: Iwamoto M, Mori C, Kojidani T, Bunai F, Hori T, Fukagawa T, Hiraoka Y, Haraguchi T (2009) Two distinct repeat sequences of Nup98 nucleoporins characterize dual nuclei in the binucleated ciliate tetrahymena. Current biology : CB 19(10):843-7

Sequences

>TTHERM_00954180(coding)
ATGAATTAGGAAGGATTTCAAGCAATCAACACTTTTCATTAAGATATAATACACGATATA
TCATTTGACTGGTATGGTTAAAGACTAGTCACTTGTTCATCTGACAGAAATGTAAAAATT
TGGCATAAAAACTAATCAGGAAAATGGGATTTATACCACTCAATCACTAATCAAGAAGGT
CCAGTTAGGAAAGTAAAATGGGCTCATCCTTAATTTGGAACTATTTTGGCTGCATGCTCA
ATGGATCGCTCTATTCATATTTATTAAGAATATAAAGATATTACTTCAATACAAAAGGAT
CCCAATGAATAATAATTATAAAAATAATGGAAACCCATCAAAATCTATAACGACAAAGAA
GTTATTGAAGACATGAAATTTGCTCCTATACATGTTGGTTTAATATTAGCTGTTGCAAGA
GCTGATGGAAGGATTAGTATTTTCCAATTTAAAGATCTTTTGAACTTACAAATTCATGAG
CAAATCTCGAATATCTCTGTCTCTCCTTTAGGAATTAATAGTATTTCTTGGAACAAAAAT
AGATTTGATAAGAAGCATATGATTGCAGTCGGATGTAAAGATAGAGATACATCTCAAACT
AAAAATTAAAATGGAATTAACGGCGTCAATTAAAAGTATATCGATGAAGAAATCAAATCC
GGTTAATCCTTCAAAATTATTGTCTTCAACAGTCTTTAAACTGTAAATGCTTAAGATCAC
TATCAAATGAAATTTGAATTCCAAGAAAGCAATGCTTAATAACTTATGCACACCTAAAAT
GTAAGTGATGTATCCTGGAGTTTAATAAATGGAAGATCTTTTCATTTAATTGCAACATGT
GGTAAAGAAGGAGCCAGAATTTGGTACATGAAACAATTATCTACAAACTAAAATGTCATA
TAAGTTATTAAAGTTATTGACTTGTTTGATCAAAATTACAGAGAAAGCATTGAAGTCCAA
AAGATATCTTGGAATATTATGGCTTCACTAGTAGCAACCTCTGACAGCAACAACGAAATT
AAAATCTTTAAATGTGTCGGAATGGGTAAATGGGAAAAAATTAAGAGTATTAAAGAAACT
TAGGATTCAGAATAATGA


>TTHERM_00954180(protein)
MNQEGFQAINTFHQDIIHDISFDWYGQRLVTCSSDRNVKIWHKNQSGKWDLYHSITNQEG
PVRKVKWAHPQFGTILAACSMDRSIHIYQEYKDITSIQKDPNEQQLQKQWKPIKIYNDKE
VIEDMKFAPIHVGLILAVARADGRISIFQFKDLLNLQIHEQISNISVSPLGINSISWNKN
RFDKKHMIAVGCKDRDTSQTKNQNGINGVNQKYIDEEIKSGQSFKIIVFNSLQTVNAQDH
YQMKFEFQESNAQQLMHTQNVSDVSWSLINGRSFHLIATCGKEGARIWYMKQLSTNQNVI
QVIKVIDLFDQNYRESIEVQKISWNIMASLVATSDSNNEIKIFKCVGMGKWEKIKSIKET
QDSEQ


>TTHERM_00954180(gene)
AAATATTATTTTTGTTTGTAATTTGATATATAAATATTTAATAAATAATAATAATAGCAA
ATAAACATACAAAGCAATTAATTAATTAATTTTTGTATTTAAAAATTAAAAAATATAATA
GCGCAAAGTTAATAAATATATTAATAGATAGATATTTTACTTAATTTTCATTTTAAAAGC
TAGTCAGTCTCACTATAAAAAATGAATTAGGAAGGATTTCAAGCAATCAACACTTTTCAT
TAAGATATAATACACGATATATCATTTGACTGTAATTATTTATTTACATTAGCAATCAAA
CCAATTAAAAGTAGCAATAAAACAGCTAGAAAAACAAATTAATGCTTTTGAAATTAGCTT
ATTAAAGCACATATTTGATTCGATTTGAATGATAAATTTATCAAATAAAAATATTTCATG
AAAATGCAGATATTTTATCTAGACAAAGAGTAAATATACTTTTATAATCAAGCAATTCTT
CTCCTTAAAAGTATAAATAAAATTATTTAGCTGGCAGAGTGCTTAGTTTAAAAAATAAGG
ATTTGTTCAAAAAATAATTATTAAGATTATTAATCTCGCTTTAAGATTTATTGATGAATT
AACAAGCTAAATTCATAAAAGATAAAAAATTATTCAGGTATAGCTATATAGTTCTCCATG
ATATTAGGAGAGTATATCTTGAATACCCCATTTCTCTTTATCCCTCGTTTGACTCCACTT
CAACTATTTAAGTCATAGCGGCAACACTTAAGGGAATGAATTTTTTCTACACTTATTTTT
TTACTAATTAAATTAATTAAATAATTTTGTTAGTATGAATCAATCATAGCTAAAATCTTT
AGCAAGATATCTTATTAAATAAAGAAAAGCTAGCATTAATTAATTATCTTACCTAACATT
TATTTATAATCAATTCATAAAATCAATTAAATATCTTATGGGTTTGCTTTCTAATCAATT
TTTATTCACATTAACAAATAAACAAAAAAACAAACAAATAAATAAATAGAATCAAAAACT
TGATTTTTTTTATTCAAATTTTATTTATAAATGGTTTCTTATATTATTTTTAGTTTTTTT
AGCTGTTTTTGCAATTAATTTACAATAAAAAATTTAATTTTGGAATAAATTTATTTTAAA
ACAAATAAATTGTTTTAAACCTGAATGAATTTTAAATTTTATTTACTTATTTTTAAATTA
ATTAATTATTAATTTCTTTATTATTTTAATGCTTGATTAAAGGGTATGGTTAAAGACTAG
TCACTTGTTCATCTGACAGAAATGTAAAAATTTGGCATAAAAACTAATCAGGAAAATGGG
ATTTATACCACTCAATCACTAATCAAGAAGGTCCAGTTAGGAAAGTAAAATGGGCTCATC
CTTAATTTGGAACTATTTTGGCTGCATGCTCAATGGATCGCTCTATTCATATTTATTAAG
AATATAAAGATATTACTTCAATACAAAAGGATCCCAATGAATAATAATTATAAAGTAATT
TATTTTTCTTTTAAAGATTTAAATTAAAATTTTTTGTTTTAGAATAATGGAAACCCATCA
AAATCTATAACGACAAAGAAGTTATTGAAGACATGAAATTTGCTCCTATACATGTTGGTT
TAATATTAGCTGTTGCAAGAGCTGATGGAAGGATTAGTATTTTCCAATTTAAAGATCTTT
TGAACTTACAAATTCATGAGCAAATCTCGAATATCTCTGTCTCTCCTTTAGGAATTAATA
GTATTTCTTGGAACAAAAATAGATTTGATAAGAAGCATATGATTGCAGTCGGATGTAAAG
ATAGAGATACATCTCAAACTAAAAATTAAAATGGAATTAACGGCGTCAATTAAAAGTATA
TCGATGAAGAAATCAAATCCGGTTAATCCTTCAAAATTATTGTCTTCAACAGTCTTTAAA
CTGTAAATGCTTAAGATCACTATCAAATGAAATTTGAATTCCAAGAAAGCAATGCTTAAT
AACTTATGCACACCTAAAATGTAAGTGATGTATCCTGGAGTTTAATAAATGGAAGATCTT
TTCATTTAATTGCAACATGTGGTAAAGAAGGAGCCAGAATTTGGTACATGAAACAATTAT
CTACAAACTAAAATGTCATATAAGTTATTAAAGTTATTGACTTGTTTGATCAAAATTACA
GAGAAAGCATTGAAGTCCAAAAGATATCTTGGAATATTATGGCTTCACTAGTAGCAACCT
CTGACAGCAACAACGAAATTAAAATCTTTAAATGTGTCGGAATGGGTAAATGGGAAAAAA
TTAAGAGTATTAAAGAAACTTAGGATTCAGAATAATGA