Identifiers and Description

Gene Model Identifier

TTHERM_00443010

Standard Name

SEC63 (translocation protein SEC63)

Aliases

PreTt05701 | 50.m00270 | 3681.m00129

Description

DnaJ domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00226 ) DnaJ domain
  • ( PF02889 ) Sec63 domain
  • ( TIGR02349 ) chaperone protein DnaJ
  • ( PF08173 ) Membrane bound YbgT-like protein
  • ( PF07997 ) Protein of unknown function (DUF1694)
  • ( TIGR03038 ) photosystem II reaction center protein

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00443010

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_12640.19.997093137033517e-262DnaJ domain-containing protein
(657 aa)
OxytrichaContig5723.0.g861.0003503620230312e-57Sec63 Brl domain
WormBaseWBGene000010471.0000422327488734e-24locus:dnj-29 status:Confirme
d UniProt:Q9U1V9 protein_i
d:CAA21710.2
Stentor CoeruleusSteCoe_254592.6102790696677047e-23
SGDYOR254C3.9992896861436003e-19SEC63 Essential subunit of Sec
63 complex (Sec63p, Sec62p, Se
c66p and Sec72p); with Sec61 c
omplex, Kar2p/BiP and Lhs1p fo
rms a channel competent for SR
P-dependent and post-translati
onal SRP-independent protein t
argeting and import into the E
R
DictyBaseDDB_G02861317.001446474249442e-19sec63 on chromosome: 4 positio
n 4064803 to 4067352

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00443010(coding)
ATGTCTAGTTTTAAAGATAATTTTACAAGAAATTAAGGAGATTAAAACCTCTAGTATGAT
GATTCAGCATTTTACTTTTTTGCTTTTTCAGTACTATCGTTTGTGTCAGTTATCACTGGT
TTATTCGTATTAAGAAACCTATTTAAGAAAGATTCTTAAATCAAAAGAGTTCATCCAAAA
GATAAATCAGCTGATTAGAAAAAACTAAATTAAGCAGTATAATTCAAGGCTCAAAAATAT
AGCTTAAAATTCTATTTTCTGATACTTTTATTTTTAGCATGTATCTACTTTGCATATCAA
ACATCGAAATTCACTGCCAAAACAGATGATTTGAAGAGATTCGATCCTTATGAGATTTTA
GAAATCCAAAGAGGAGCTTCTTAGGGAGAAATTAAAAAAGCATACAGAAAAATGGTGTTA
TTATATCACCCTGATAAGAATCCTAGTCCCGAAGCCGCTGCTAAATTCTTATTAGTTACT
AAAGCTAATGAGTGTTTAACTGATGAAACAAAGATGAAAGTTTGCGAATAATTTGGTAGT
CCTGATGGTCCTGGTTCATTGCAAGTAGCTATTGCAATGCCTTCATTCTTTTAAAAGAAA
GAAAATCACGTTTTTGTTTTAGCCTTATTTTCCGTTCTTTTTGTCATATTAGTACCTATT
GTTGTTTTAATATGGTTAAACAGATCTCAATCCAAAAACAACCATGGAATGTTAGTTGAA
AACTATATGGTAGCTTTCTAAAAAATGACCCAAAATATGGCAGCATCGAAGCTAATTGAA
ATAATTGGTTATTGTGCCGAATTTAGATTCCCAATAACAAGATAAGAACAAGAATACTTT
ACCAAAAAAACTTAATTTTTAGAAGAGTATCAAACTTCAAAGAATACCATTTCCACTAAG
GGTTAAAAATTGCTTATTTTATATTTTGAAGGAATTGAAATTCCTAAGGAATCTTAGAAG
CACTTTGCTTAATTGATGAGTTAAACTCCTTGCATTTTAGAGAGTGCTGTTGAACATTGC
CTTTAATTAAATGCAATGCTTCCTAAAGGAAATCCAAGATATTTAAGTGTTTAAACTCTT
CTTAATACCATTCACTTCTAATAGCATTTCTTTTAGGGAGTTTGGTCTACTAAGTATGAT
ATGGATCTTATGCAAATTTCATCTGTCCAAAGCGATAAAGTTAGTTTTAAAAAACTCTAT
TAAAAATATAGAAACTTAAAAACTTTGTAAAATACACCTGTTGAGTAAAGAAAATATGAT
ATCTAAGTTAATTTAGATGAGGCTAAAAAATAAAAATTCATAGATGAAGTCAACTAAGAG
GTAGATTCTTTCCCTAATATGAAAATGCAATTCGATGTTTTGCTAGATGAACAAGAAAGC
AGTGGAACCTATAGAGCAACTTCATAAGAAAATAAAACTGTTTCTCTTACTATTGAAGAA
GGTTAAATTTTTAATCTTAAAGTAGGCATCACTCGTGAAAATATTCCTGAAAAAGAAGAG
GGAATGTTTGCAATCTGTCACAAATATCCTTACGTTAAAGACATGTATTTACATGTATTT
GTCACTGACAAAGAAAGAATTTTCTAATACCAGCAATTAACTGGACAAGCTAGATATATT
GAATTCAATGAGAAAATGGCATTACCTCAAGGAGAATTTAGTTTAGAATTACATGTTAAA
CCAGATTGCTATATTGGAATGGATGAAGTTTTTAAATTTAACTTGAAAGTAACTCCTCGT
ACTGAAAAACACCAAAACGAAGATGATATTCATCCTGAAGATATTGAAAAATTCAAAGAA
CCTACATTTGTTTAAAAACTAATGGGTCAATTACAAGAGTAAGAACAAGAAGAAGAAGAG
GATGAAATCCCTGATATCACAAAAGACCTTGGAAAAGCAAATACTAATGATGATTAAGAA
GAAGAAAAAGAAGAATCAGAAAATGAATAGTAAAAGAGTGATGATAAAAAGAAAAACTGA


>TTHERM_00443010(protein)
MSSFKDNFTRNQGDQNLQYDDSAFYFFAFSVLSFVSVITGLFVLRNLFKKDSQIKRVHPK
DKSADQKKLNQAVQFKAQKYSLKFYFLILLFLACIYFAYQTSKFTAKTDDLKRFDPYEIL
EIQRGASQGEIKKAYRKMVLLYHPDKNPSPEAAAKFLLVTKANECLTDETKMKVCEQFGS
PDGPGSLQVAIAMPSFFQKKENHVFVLALFSVLFVILVPIVVLIWLNRSQSKNNHGMLVE
NYMVAFQKMTQNMAASKLIEIIGYCAEFRFPITRQEQEYFTKKTQFLEEYQTSKNTISTK
GQKLLILYFEGIEIPKESQKHFAQLMSQTPCILESAVEHCLQLNAMLPKGNPRYLSVQTL
LNTIHFQQHFFQGVWSTKYDMDLMQISSVQSDKVSFKKLYQKYRNLKTLQNTPVEQRKYD
IQVNLDEAKKQKFIDEVNQEVDSFPNMKMQFDVLLDEQESSGTYRATSQENKTVSLTIEE
GQIFNLKVGITRENIPEKEEGMFAICHKYPYVKDMYLHVFVTDKERIFQYQQLTGQARYI
EFNEKMALPQGEFSLELHVKPDCYIGMDEVFKFNLKVTPRTEKHQNEDDIHPEDIEKFKE
PTFVQKLMGQLQEQEQEEEEDEIPDITKDLGKANTNDDQEEEKEESENEQQKSDDKKKN


>TTHERM_00443010(gene)
ATGTCTAGTTTTAAAGATAATTTTACAAGAAATTAAGGAGATTAAAACCTCTAGTATGAT
GATTCAGCATTTTACTTTTTTGCTTTTTCAGTACTATCGTTTGTGTCAGTTATCACTGGT
TTATTCGTATTAAGAAACCTATTTAAGAAAGATTCTTAAATCAAAAGAGTTCATCCAAAA
GATAAATCAGCTGATTAGAAAAAACTAAATTAAGCAGTATAATTCAAGGCTCAAAAATAT
AGCTTAAAATTCTATTTTCTGGTAAGTAAATTAATTTTAAACTATAATCCTTTTTTTAAA
TCCATCAATTTTCAAAAAATAGATACTTTTATTTTTAGCATGTATCTACTTTGCATATCA
AACATCGAAATTCACTGCCAAAACAGATGATTTGAAGAGATTCGATCCTTATGAGATTTT
AGAAATCCAAAGAGGAGCTTCTTAGGGAGAAATTAAAAAAGCATACAGGTATATTTTATA
AAAATATTTAGTTTATAGATTTAAAAGATTTGGATGCGAATTTCTAATTTAAAATTAACT
ACCTTAATTCACAAATATTAAAATGTTAAAAATTTATTTCAATAAATAGAAAAATGGTGT
TATTATATCACCCTGATAAGAATCCTAGTCCCGAAGCCGCTGCTAAATTCTTATTAGTTA
CTAAAGCTAATGAGTGTTTAACTGATGAAACAAAGATGAAAGTTTGCGAATAATTTGGTA
GTCCTGATGGTCCTGGTTCATTGCAAGTAGCTATTGCAATGCCTTCATTCTTTTAAAAGA
AAGAAAATCACGTTTTTGTTTTAGCCTTATTTTCCGTTCTTTTTGTCATATTAGTACCTA
TTGTTGTTTTAATATGGTTAAACAGATCTCAATCCAAAAACAACCATGGTAAATTATGAT
TCTTAATACATTATTTTTATTGATTTTTGATTAATTTATTAATAAAGGAATGTTAGTTGA
AAACTATATGGTAGCTTTCTAAAAAATGACCCAAAATATGGCAGCATCGAAGCTAATTGA
AATAATTGGTTATTGTGCCGAATTTAGATTCCCAATAACAAGATAAGAACAAGAATACTT
TACCAAAGTAATTTTAAAAATATGAAATTAAGATAATAAAATTGTATTAAATTATAAAGA
AAACTTAATTTTTAGAAGAGTATCAAACTTCAAAGAATACCATTTCCACTAAGGGTTAAA
AATTGCTTATTTTATATTTTGAAGGAATTGAAATTCCTAAGGAATCTTAGAAGCACTTTG
CTTAATTGATGAGTTAAACTCCTTGCATTTTAGAGAGTGCTGTTGAACATTGCCTTTAAT
TAAATGCAATGCTTCCTAAAGGAAATCCAAGATATTTAAGTGTTTAAACTCTTCTTAATA
CCATTCACTTCTAATAGCATTTCTTTTAGGTATGTTAATTAGTTAAAGTATATTTTTAAT
TTACTTACATTTTTATTAAAGGGAGTTTGGTCTACTAAGTATGATATGGATCTTATGCAA
ATTTCATCTGTCCAAAGCGATAAAGTTAGTTTTAAAAAACTCTATTAAAAATATAGAAAC
TTAAAAACTTTGTAAAATACACCTGTTGAGTAAAGAAAATATGATATCTAAGTTAATTTA
GATGAGGCTAAAAAATAAAAATTCATAGATGAAGTCAACTAAGAGGTAGATTCTTTCCCT
AATATGAAAATGCAATTCGATGTTTTGCTAGATGAACAAGAAAGCAGTGGAACCTATAGA
GCAACTTCATAAGAAAATAAAACTGTTTCTCTTACTATTGAAGAAGGTTAAATTTTTAAT
CTTAAAGTAGGCATCACTCGTGAAAATATTCCTGAAAAAGAAGAGGGAATGTTTGCAATC
TGTCACAAATATCCTTACGTTAAAGACATGTATTTACATGTATTTGTCACTGACAAAGAA
AGAATTTTCTAATACCAGCAAGTAAAAATAAATAATAAATAAAAAAAGTAGATTAAAATG
GAAAATATTTATAAAAAAGTTAACTGGACAAGCTAGATATATTGAATTCAATGAGAAAAT
GGCATTACCTCAAGGAGAATTTAGTTTAGAATTACATGTTAAACCAGATTGCTATATTGG
AATGGATGAAGTTTTTAAATTTAACTTGAAAGTAACTCCTCGTACTGAAAAAGTAAATTA
AACATTTTTTGATAGTAAAATTTGTAATATTTATTAAAATTTAAATTAATATCAGCACCA
AAACGAAGATGATATTCATCCTGAAGATATTGAAAAATTCAAAGAACCTACATTTGTTTA
AAAACTAATGGGTCAATTACAAGAGTAAGAACAAGAAGAAGAAGAGGATGAAATCCCTGA
TATCACAAAAGACCTTGGAAAAGCAAATACTAATGATGATTAAGAAGAAGAAAAAGAAGA
ATCAGAAAATGAATAGTAAAAGAGTGATGATAAAAAGAAAAACTGA