Identifiers and Description

Gene Model Identifier

TTHERM_00666300

Standard Name

SEC62 (translocation protein SEC62)

Aliases

PreTt23883 | 99.m00124

Description

Translocation protein Sec62 containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF05366 ) Sarcolipin
  • ( PF03839 ) Translocation protein Sec62
  • ( TIGR00869 ) protein translocation protein, Sec62 family

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.5%

TetraMine Data

TTHERM_00666300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_16544.19.995404496431436e-166translocation protein Sec62 co
ntaining protein (350 aa)
OxytrichaContig12166.0.g835.000468829272308e-18Translocation protein Sec62
SGDYPL094C0.0000000000019997478866288316SEC62 Essential subunit of Sec
63 complex (Sec63p, Sec62p, Se
c66p and Sec72p); with Sec61 c
omplex, Kar2p/BiP and Lhs1p fo
rms a channel competent for SR
P-dependent and post-translati
onal SRP-independent protein t
argeting and import into the E
R
Stentor CoeruleusSteCoe_132050.000000000005109089028063325
WormBaseWBGene000076830.0000000006000548789370351status:Confirmed UniProt:Q18
093 protein_id:CAA93853.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00666300(coding)
ATGGTAAAAGAAGATAGAGAACGTAAGCGCTAATAGAGAGAATAGGACGTTATGAAATCT
GAATAGGCTGAAAAGAAAAAGAAACTCTTCAGCTATAGTTCATTCATAGAGTTCTTGAGA
AATAATAACTTGAGAGAAACAAACATCATCCTAGGTTAGTCCAGATTCAACTTATTCAAT
GGAAGACAGTTTGCAGAAATACTAGAAAGACATCACAATGAAATAGTTGAAATACTTAAA
GATTACTATGATGATGAATCAGAGGCATTAGAAGGCAAAAAAAGAGTTAATCTTGTTAAC
TTCCTTATACAAGAACATATTATTGTTAAAGTCGAATAGACAGTATAAAAATCGAAAATA
AAAACTATCACTGACATGTACACAGCTAGCAAGTAATAACAAGTTGAAGAAGATTCTTAA
ATTATATCTGGATTCTTTGTTTTTAATCCACACATTAAAGTCTAATCCAAAAAAAACTAC
GTCTATATGATCCTTATTCTTATTGGCATTGCCCTCATCATCCTCTTTCCCGTCTGGCCT
ATTTCCATCAAAAAGCTTATTTTCTATATCTCTGTAGTCATGCTCTTTGTATTACTTGGT
TTGATCTTAGTCAGAACATTTTTATACTTTTTAGTTAGAATTTTCGGATTCGACTTCTAT
ATCTTCCCTAATCTCTTTGCAGATGTAGGATTTTTAGACTCATTCAAGCCTATTATTTAA
CTTGATTAATGTAATGATAGCAAATTGGAGTTACTTTTTAGATTTGTAGGTTTCTTTATT
ATGGGTTATGTTATCTATATCTTAAGCATAGAGAGACATTCAGTTAAATAATTCAGTACA
GCAACATTTGATGATATCATAGATTGGGGATACCAAAAACTTGAATATGTTTAGCCTGAA
GCTCCTCACAATAGTATCTTACATGAAATTGAAAAGGAAGATTTAGAAGAAAGATTAAAG
TAACAAAATTAAAATTAAGAGCAACATGGCACATAATTTGATGAACCTCAAAATGATGAG
CAACATGGAACATAATTTGATGAACCTCAAAATAATGATAATTGA


>TTHERM_00666300(protein)
MVKEDRERKRQQREQDVMKSEQAEKKKKLFSYSSFIEFLRNNNLRETNIILGQSRFNLFN
GRQFAEILERHHNEIVEILKDYYDDESEALEGKKRVNLVNFLIQEHIIVKVEQTVQKSKI
KTITDMYTASKQQQVEEDSQIISGFFVFNPHIKVQSKKNYVYMILILIGIALIILFPVWP
ISIKKLIFYISVVMLFVLLGLILVRTFLYFLVRIFGFDFYIFPNLFADVGFLDSFKPIIQ
LDQCNDSKLELLFRFVGFFIMGYVIYILSIERHSVKQFSTATFDDIIDWGYQKLEYVQPE
APHNSILHEIEKEDLEERLKQQNQNQEQHGTQFDEPQNDEQHGTQFDEPQNNDN


>TTHERM_00666300(gene)
ATGGTAAAAGAAGATAGAGAACGTAAGCGCTAATAGAGAGAATAGGACGTTATGAAATCT
GAATAGGCTGAAAAGAAAAAGAAACTCTTCAGCTATAGTTCATTCATAGAGTTCTTGAGA
AATAATAACTTGAGAGAAACAAACATCATCCTAGGTTAGTCCAGATTCAACTTATTCAAT
GGTAAACAAATATATATTCATTATTTAGGTTATTCTCAAAACTTTAAAAGCATGATTGAA
ATCTCATTTAAGACAAGAAAATATTAATTAAGGAGCGAGATATATTAATAGATTGTGTCC
TTTAGCAGTTTAATTATCTTTAGCCTTCTGCTACGGCATTTTAATTTTAGGTTTAGTTTA
TGCTGCTTCATATTATACATGAAAAATAAATAAAAAAACAATTTATTTATAAAAGTACAT
TATGTATAAAATAAACCTTCTAGGCTAGCATTTTTAAAGTAGCTAACAGAGATAAAGATA
GGAATAAAATATATATTGAATTATTAGCTTTTAGCTTCTTACAATCAAATACATTTATAT
TGATTTAATGATTATTTTAATAAAATAATCTAACAGGAAGACAGTTTGCAGAAATACTAG
AAAGACATCACAATGAAATAGTTGAAATACTTAAAGATTACTATGATGATGAATCAGAGG
CATTAGAAGGCAAAAAAAGAGTTAATCTTGTTAACTTGTAAAAAAAATTAGTTTTGTGTA
GCAAATATGCAAGTTTTGAATATTATTTTTATAAAACTTTAGCCTTATACAAGAACATAT
TATTGTTAAAGTCGAATAGACAGTATAAAAATCGAAAATAAAAACTATCACTGACATGTA
CACAGCTAGCAAGGTAGTCTTTCATTTACCTTTAGATTTTTTTGTTTCTTCAATGAAAGC
ATTAATTTTAGGCTTTACGTTATGCTTGCATTTAAACTGATTTAATATTTTAATTAAATT
AACAATTATTTTGGATCAAACGTGGCTAATTGTTTATTTATTTATTTAATATACCTAATA
AAAACAGTAATAACAAGTTGAAGAAGATTCTTAAATTATATCTGGATTCTTTGTTTTTAA
TCCACACATTAAAGTCTAATCCAAAAAAAACTACGTCTATATGATCCTTATTCTTATTGG
CATTGCCCTCATCATCCTCTTTCCCGTCTGGCCTATTTCCATCAAAAAGCTTATTTTCTA
TATCTCTGTAGTCATGCTCTTTGTATTACTTGGTTTGATCTTAGTCAGAACATTTTTATA
CTTTTTAGTTAGAATTTTCGGATTCGACTTCTATATCTTCCCTAATCTCTTTGCAGTAAA
TATTGATTATTTCATCAAATCTTCTATTAAATTCTTTATTTATTTAATTAATTAGGATGT
AGGATTTTTAGACTCATTCAAGCCTATTATTTAACTTGATTAATGTAATGATAGCAAATT
GGAGTTACTTTTTAGATTTGTAGGTTTCTTTATTATGGGTTATGTTATCTATATCTTAAG
CATAGAGAGACATTCAGTTAAATGTAAAATTATATGATCATTTTGATGATTAAGCTTTTT
TTTCTTCAATTATTATTTATTTATTTTAAAAGAATTCAGTACAGCAACATTTGATGATAT
CATAGATTGGGGATACCAAAAACTTGAATATGTTTAGGTAATAAAAAGATTTAGAGCCAA
TTTCCAAATTTAATATTTTAAAATTAAAATTATCTATCTAGCCTGAAGCTCCTCACAATA
GTATCTTACATGAAATTGAAAAGGAAGATTTAGAAGAAAGATTAAAGTAACAAAATTAAA
ATTAAGAGCAACATGGCACATAATTTGATGAACCTCAAAATGATGAGCAACATGGAACAT
AATTTGATGAACCTCAAAATAATGATAATTGA