Identifiers and Description

Gene Model Identifier

TTHERM_00530790

Standard Name

SEC61 (translocation protein SEC61)

Aliases

PreTt04742 | 67.m00257 | 3684.m00127

Description

preprotein translocase, SecY subunit containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

  • phosphatidylinositol phosphate kinase activity (IEA) | GO:0016307
  • P-P-bond-hydrolysis-driven protein transmembrane transporter activity (IEA) | GO:0015450

Biological Process

Domains

  • ( TIGR01612 ) rhoptry protein
  • ( TIGR00864 ) polycystin cation channel protein
  • ( PF00344 ) preprotein translocase, SecY subunit
  • ( PF05316 ) Mitochondrial ribosomal protein (VAR1)
  • ( TIGR00967 ) preprotein translocase, SecY subunit
  • ( TIGR02920 ) accessory Sec system translocase SecY2
  • ( PF01504 ) Phosphatidylinositol-4-phosphate 5-Kinase
  • ( TIGR02366 ) probable dihydroxyacetone kinase regulator

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10%

TetraMine Data

TTHERM_00530790

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13576.19.997093137033517e-262preprotein translocase, SecY s
ubunit containing protein (148
6 aa)
OxytrichaContig11119.0.g111.9994920269952867e-34Phosphatidylinositol-4-phospha
te 5-Kinase
DictyBaseDDB_G02675881.9996410647472548e-29pikI on chromosome: 1 position
376992 to 379294
WormBaseWBGene000040878.998359040303252e-24locus:ppk-1 status:Confirmed
UniProt:O01759 protein_id
:CCD65437.1
SGDYDR208W2.9990241513684e-21MSS4 Phosphatidylinositol-4-ph
osphate 5-kinase, involved in
actin cytoskeleton organizatio
n and cell morphogenesis; mult
icopy suppressor of stt4 mutat
ion
Stentor CoeruleusSteCoe_227570.000000000000012664165549094176

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00530790(coding)
ATGTTATATATACCTTTTGGTGAAGATGATTAATTTTAATATTTTTTGAGAATTAAAATA
ATAATACACTTCAGAAAAAAAATATAAATTAGCAGTAGGAAGACTATTTAAGCAGTGAAA
TCATAAAGGCAGTCTACCTATCACTCAATTTAAAACGACATAGCAAAATAGTTTTAAAAA
ATAGGAATTAAGCTAGATCTAATCCATATCCTCTTTGGAGTTAAGGCTCTTTAAAGAAAT
TAGGAATAATCAGAATAATAGCATTTATTTAATCATCATAGATTTACCAAAATGAAGTCC
AATACACAAATAATATTATTTATAATTATTTCATAGCTTTGCTATGTTGTAAATGCATCC
CAACACAATGACTAAGGTCGAACTTTAGATAACGATAATCAAATATCATCAAATGATGCG
ATTTTAAATTGCAGAACTCATTCTTTTTCAGATCATTTGCCTGTTGTTAAGCTTTCAACA
AGAGATTCGTGGATTTTACTTATAGGATCATCTATCGCCTTAATAATTTAAATAAGCTTT
TTTGCATTAGCTATTAAAGTTCCTCGCTTGAGACAGTAACCTGGAGATATTTTGTTAGGA
TGCTTTTGTGCAGAATTTATTCTTTCAATCCATTGGTTTATTATGAGTCTTGAAGCTATA
TTGTATCCTAATAACATTTTAAACCAAGATGATGCTTTTTGTCAGCTTAATAGTATTATT
AGTATATTTGGTAGTGCTATGTAAGGCTTATATAACTTTTTCTTTTTCCTTTTTATAGGT
CTTTCTATCAAGAGTAGTTTAAGTATATAGTCTATATCAAGGAAAAAAACTCATGGGTTG
TTAATAGGAACAGCTTTATTGATTTTAATAACAATATTCTTTTTAGATTTAAATGGAAAA
ACTCTCTATGGTACATGCTCATATGTTTCAGACTAATCCTTTCCGATGTTATCATTGATA
TTTTATCTTCTATTTTTGTTTTTTTCGATACTAATTCTTGCGTATTTTAATCAAAAAATA
CCAAATACTTCTTTCTATAAGAAAAAAAGAAAGGAATTTCTCCACTTTTCAAGGCTATAT
CTTTCAGTCTGCTTATTTATGTGGGGTGTAATTGCTATTAGCAATACAGCCTTATTTTTT
AATTGCTAGTACGTCCATTAGTAATATCTCACTTACTTTTAAACTATCGGAAATACAGCA
AAAGTACTTTCCTCAATTTTACTTCCTATGATCAGAATTAAAGATCCTTACCTAAGGTCT
ATAATCAGGCAATAAAAAAAAATATTAAAACAAAAAGCAACTTCAATAGTTCCTAATGCA
AAAACAGAATAATAAAATATAAGTAACACTGAAAAAAGTTATATGAATGATAATACCAGC
TCTTAAAATAATCAAACTGATAATAGTTAAGCGTATTATAACAAGCCTAAATCATAAAAT
TAATCATATGATGACAATTCTTTTGTTTCAAGCTTTTCTGTATCAAAAGAACAAATAAGC
AGCTTATAGCAAAAATACAGAGATTTTAAAAACAAATAAAATGTTACAGATGATGGGAAA
AGTAATGCTGGTAATACAATAATAGTCGAATAAAACAAAAATGATAATAATGAATCACTA
TCATTATAAGAAATTGAAGAAAGATTGTCAATTTTTGACAATGAGAATTAAGACAATTAA
AAATAAAAAGTGGAAGAAAATTAGAAAGTAAGAAAATCTAATGCAGCTCAAATGCTTTCA
GTTTAGTCTACTTACTAAACTTAAACTTTTCCGAGATTCTAGTCTAGCTTCAATAAAAGC
GAAAGTATTGATTAAGTTGGTTTTAAGATACCTACTGGCTAATAAGTTAAAGAGGATATA
GAAAATATCAATTTAAAATAAAGGAACAAAACTATTTTTTCTAGGCTTGAAAAAAAAGGA
AATTCTATCATAAAAGAAGAAAATAATTCTTTAGATTCAAACAGATCACGTTTTTTATCA
AATAAAGAAAATAAGGCTAGCAGAATCTCTTAGCTATAAGCTTTCAAATTTAGTAATTAA
TCTAGAACTAGCTAATTGAAAATATAAGAAAGTAGTGCAAATTAAATTTAGTTGCCAAGT
GTCAATTCAAGTATGACTATGAATTCACCTATTAATTCAAATAATAATTCTAAATCAATA
GATTCTTCAAATAATATTAAAAACAGAAGCATCAAGATAAACTCAAGAAAACCTAGTGCT
ATGCAAAAATTTTAATAAGCAGATTCCATACTATATTATTTGGATGGCTCTAGATAAAGT
TCTAAGATGTTTCAAAACAGAAGAAATGAATTTAGAAAGACTCTGAATTAAGAAGTTAAT
AAAAAAAGATTTAATTATAAGCTTTTTGAGTATTTAAAAAATAATTCAATTGCAAGTGAA
TTGAATGGTAGCCAATCGTATTCTGTAGATGCTTCTGATTAGAATAGAAATGTAAGTGGT
GAAGAAGCAATACTAAAATAAAAGTTATAATAAATAATAAAAAATGCCTAAATGATGGAT
TATTTCAATGATCCTTATTACTAAGTTCAAAATTAGAGTGAAAGTGGCTCATTTACTGAT
ATAGATGCAGTTTTTGGAGACGAATCGCTATCTTCTGGCTCTTCAGTTCGATATGGTAAC
TCTTAACTATAAGCAGAAACTTTTGAGGATGAAAAAGAGCATTTTATAAGAATTTTATAG
AAAAATATAAAAATGGGTGTGCTTTGTAGAATTCTTAGTGGAATTTAAATTCACTTTATG
AGAAAGAAAAGATACTGTTCTAAAGTTGATATATTCACAGATAATTATAATTCTATTTTT
GAATGTTAAGTCAACTCTATAAAACTCAATAAAAATTCATCTTAATTATCATCATAGAAG
TCATCAGTGCGCTATTCTCAAACTGGTTTTTATGAATAATTTAAAACACTTGAAGATAAT
AAATAAGAAACTGAGCAAATAAAAGACTTTTAAAATGATAAATAATAGAAAAGAGTGAAA
TTAAACATAAATAACCATTCTCTAAATGATTCATGTCATAATCAGAAAAATACAATAATA
TATTCTAATAATCTTCAGAAAATGGAAGAAGAAAATAAAAACTAAGATATATTTATGAAA
TCTGAAAATATTTACAATAAATCTAATATAATATAACTTGATAAAAATAGCAGATAAAAA
TCTTACAGCTAAAACTAGTAAATTAATCTTAGGCAAGTCTCACTCTCATTAACAAATAAT
AATAACAAAAAAAAATCTTAAAAGTAGCAAGAAAATGATATTTTTTATGAGGTAAAAATT
TTCTAATTTTCTGATGATTCTATCAAACAAAACTTGAATCATGCACCTACATAACTTTTA
GATAGTGATACTTTTGATCTCGTTAGAATGAGAGTATATGCACCTACAGTTTTTCATAGT
CTGCAACAATCAGAAATTAATTTGATTTTAAATTAAGAAGACACTGATCCATATAAATAA
AAACATAACATAGACATAGAAAATTCATTTAATATCTAGCTCAATATGACTTAAATAAAA
AATGCTAGTGGATCAGATGGAGGAAAAAGTGGATAATTCTTTTTTTTCTCCCATGATAAC
AAATTTTTGCTAAAAACATGCACAGAATAAGAGCTTAGAATTCTAATTGAAAGGCTACCT
TCATATTTCCGATATTTAAAGGCAAATCCTAGAAGTTTAATAGCTAAAATTTTCGGAGTA
TACTCATTTGAAGGTTTAAATGAAAAACCTATACACTTATTATTGATGAAAAATATAGCA
GCATGTACAAAATAATTTATTGAAAGGACATATGATCTAAAAGGCTCAACTTTCGATAGA
TAGGTTTTACCTAAGACTAAAAAAGAATCAGAATCCTTCTCAAGAGCGCTAAATAGAATG
ATTCTAAAAGACCTAGATTTTATCAGCTTGGAAAAAAAAATATACATTTCGTTAGAAAAT
AGATTTTAGGTGTATAATTAACTTAAAAGAGATTCAGAATTTTTAAAATCATGTGGCTGG
ATAGACTACAGCTTGATTGTTTTCAAAATAAATAGAAAGAGGCATACAGAGTGGAAGGAA
TCAAACTAAGTAGCCTATTTAGAAGAAGAGGAAGATTTTGATGATTAAATTTCTCATTAT
TACTAATTTGAATCTACAGAATAAAGTGGAATTTATTATCACATAGGAATTATAGATTAT
CTATAGTTGTATGATATCTAAAAAGTATTAGAAAAGTGGGCAAAAAGAATTATTCACTTT
AGTCCAAGACTTGATACATCATCATAAGATCCTGAAACTTATAGTAAAAGATTTATAAAC
TTTATGAAATAAATTTTTGAAATTTGA


>TTHERM_00530790(protein)
MLYIPFGEDDQFQYFLRIKIIIHFRKKIQISSRKTIQAVKSQRQSTYHSIQNDIAKQFQK
IGIKLDLIHILFGVKALQRNQEQSEQQHLFNHHRFTKMKSNTQIILFIIISQLCYVVNAS
QHNDQGRTLDNDNQISSNDAILNCRTHSFSDHLPVVKLSTRDSWILLIGSSIALIIQISF
FALAIKVPRLRQQPGDILLGCFCAEFILSIHWFIMSLEAILYPNNILNQDDAFCQLNSII
SIFGSAMQGLYNFFFFLFIGLSIKSSLSIQSISRKKTHGLLIGTALLILITIFFLDLNGK
TLYGTCSYVSDQSFPMLSLIFYLLFLFFSILILAYFNQKIPNTSFYKKKRKEFLHFSRLY
LSVCLFMWGVIAISNTALFFNCQYVHQQYLTYFQTIGNTAKVLSSILLPMIRIKDPYLRS
IIRQQKKILKQKATSIVPNAKTEQQNISNTEKSYMNDNTSSQNNQTDNSQAYYNKPKSQN
QSYDDNSFVSSFSVSKEQISSLQQKYRDFKNKQNVTDDGKSNAGNTIIVEQNKNDNNESL
SLQEIEERLSIFDNENQDNQKQKVEENQKVRKSNAAQMLSVQSTYQTQTFPRFQSSFNKS
ESIDQVGFKIPTGQQVKEDIENINLKQRNKTIFSRLEKKGNSIIKEENNSLDSNRSRFLS
NKENKASRISQLQAFKFSNQSRTSQLKIQESSANQIQLPSVNSSMTMNSPINSNNNSKSI
DSSNNIKNRSIKINSRKPSAMQKFQQADSILYYLDGSRQSSKMFQNRRNEFRKTLNQEVN
KKRFNYKLFEYLKNNSIASELNGSQSYSVDASDQNRNVSGEEAILKQKLQQIIKNAQMMD
YFNDPYYQVQNQSESGSFTDIDAVFGDESLSSGSSVRYGNSQLQAETFEDEKEHFIRILQ
KNIKMGVLCRILSGIQIHFMRKKRYCSKVDIFTDNYNSIFECQVNSIKLNKNSSQLSSQK
SSVRYSQTGFYEQFKTLEDNKQETEQIKDFQNDKQQKRVKLNINNHSLNDSCHNQKNTII
YSNNLQKMEEENKNQDIFMKSENIYNKSNIIQLDKNSRQKSYSQNQQINLRQVSLSLTNN
NNKKKSQKQQENDIFYEVKIFQFSDDSIKQNLNHAPTQLLDSDTFDLVRMRVYAPTVFHS
LQQSEINLILNQEDTDPYKQKHNIDIENSFNIQLNMTQIKNASGSDGGKSGQFFFFSHDN
KFLLKTCTEQELRILIERLPSYFRYLKANPRSLIAKIFGVYSFEGLNEKPIHLLLMKNIA
ACTKQFIERTYDLKGSTFDRQVLPKTKKESESFSRALNRMILKDLDFISLEKKIYISLEN
RFQVYNQLKRDSEFLKSCGWIDYSLIVFKINRKRHTEWKESNQVAYLEEEEDFDDQISHY
YQFESTEQSGIYYHIGIIDYLQLYDIQKVLEKWAKRIIHFSPRLDTSSQDPETYSKRFIN
FMKQIFEI


>TTHERM_00530790(gene)
ATGTTATATATACCTTTTGGTGAAGATGATTAATTTTAATATTTTTTGAGAATTAAAATA
ATAATACACTTCAGAAAAAAAATATAAATTAGCAGTAGGAAGACTATTTAAGCAGTGAAA
TCATAAAGGCAGTCTACCTATCACTCAATTTAAAACGACATAGCAAAATAGTTTTAAAAA
ATAGGAATTAAGCTAGATCTAATCCATATCCTCTTTGGAGTTAAGGCTCTTTAAAGAAAT
TAGGAATAATCAGAATAATAGCATTTATTTAATCATCATAGATTTACCAAAATGAAGTCC
AATACACAAATAATATTATTTATAATTATTTCATAGCTTTGCTATGTTGTAAATGCATCC
CAACACAATGACTAAGGTCGAACTTTAGATAACGATAATCAAATATCATCAAATGATGCG
ATTTTAAATTGCAGAACTCATTCTTTTTCAGATCATTTGCCTGTTGTTAAGCTTTCAACA
AGAGATTCGTGGATTTTACTTATAGGATCATCTATCGCCTTAATAATTTAAATAAGCTTT
TTTGCATTAGCTATTAAAGTTCCTCGCTTGAGACAGTAACCTGGAGATATTTTGTTAGGA
TGCTTTTGTGCAGAATTTATTCTTTCAATCCATTGGTAACTAATTTTTGATTTAATTTCA
ATATAAAAATTCCATTTATTTTAAATTAAAGCAATTTAGAATTTGCAAGCATTTTGAAAT
ACTTTTCTTTTTACTAAATAAAATTCACATTTATTTCTTAATAACTAGGTTTATTATGAG
TCTTGAAGCTATATTGTATCCTAATAACATTTTAAACCAAGATGATGCTTTTTGTCAGCT
TAATAGTATTATTAGTATATTTGGTAGTGCTATGTAAGGCTTATATAACTTTTTCTTTTT
CCTTTTTATAGGTCTTTCTATCAAGAGTAGTTTAAGTATATAGTCTATATCAAGGAAAAA
AACTCATGGGTTGTTAATAGGAACAGCTTTATTGATTTTAATAACAATATTCTTTTTAGA
TTTAAATGGAAAAACTCTCTATGGTACATGCTCATATGTTTCAGACTAATCCTTTCCGAT
GTTATCATTGATATTTTATCTTCTATTTTTGTTTTTTTCGATACTAATTCTTGCGTATTT
TAATCAAAAAATACCAAATACTTCTTTCTATAAGAAAAAAAGAAAGGAATTTCTCCACTT
TTCAAGGCTATATCTTTCAGTCTGCTTATTTATGTGGGGTGTAATTGCTATTAGCAATAC
AGCCTTATTTTTTAATTGCTAGTACGTCCATTAGTAATATCTCACTTACTTTTAAACTAT
CGGAAATACAGCAAAAGTACTTTCCTCAATTTTACTTCCTATGATCAGAATTAAAGATCC
TTACCTAAGGTCTATAATCAGGCAATAAAAAAAAATATTAAAACAAAAAGCAACTTCAAT
AGTTCCTAATGCAAAAACAGAATAATAAAATATAAGTAACACTGAAAAAAGTTATATGAA
TGATAATACCAGCTCTTAAAATAATCAAACTGATAATAGTTAAGCGTATTATAACAAGCC
TAAATCATAAAATTAATCATATGATGACAATTCTTTTGTTTCAAGCTTTTCTGTATCAAA
AGAACAAATAAGCAGCTTATAGCAAAAATACAGAGATTTTAAAAACAAATAAAATGTTAC
AGATGATGGGAAAAGTAATGCTGGTAATACAATAATAGTCGAATAAAACAAAAATGATAA
TAATGAATCACTATCATTATAAGAAATTGAAGAAAGATTGTCAATTTTTGACAATGAGAA
TTAAGACAATTAAAAATAAAAAGTGGAAGAAAATTAGAAAGTAAGAAAATCTAATGCAGC
TCAAATGCTTTCAGTTTAGTCTACTTACTAAACTTAAACTTTTCCGAGATTCTAGTCTAG
CTTCAATAAAAGCGAAAGTATTGATTAAGTTGGTTTTAAGATACCTACTGGCTAATAAGT
TAAAGAGGATATAGAAAATATCAATTTAAAATAAAGGAACAAAACTATTTTTTCTAGGCT
TGAAAAAAAAGGAAATTCTATCATAAAAGAAGAAAATAATTCTTTAGATTCAAACAGATC
ACGTTTTTTATCAAATAAAGAAAATAAGGCTAGCAGAATCTCTTAGCTATAAGCTTTCAA
ATTTAGTAATTAATCTAGAACTAGCTAATTGAAAATATAAGAAAGTAGTGCAAATTAAAT
TTAGTTGCCAAGTGTCAATTCAAGTATGACTATGAATTCACCTATTAATTCAAATAATAA
TTCTAAATCAATAGATTCTTCAAATAATATTAAAAACAGAAGCATCAAGATAAACTCAAG
AAAACCTAGTGCTATGCAAAAATTTTAATAAGCAGATTCCATACTATATTATTTGGATGG
CTCTAGATAAAGTTCTAAGATGTTTCAAAACAGAAGAAATGAATTTAGAAAGACTCTGAA
TTAAGAAGTTAATAAAAAAAGATTTAATTATAAGCTTTTTGAGTATTTAAAAAATAATTC
AATTGCAAGTGAATTGAATGGTAGCCAATCGTATTCTGTAGATGCTTCTGATTAGAATAG
AAATGTAAGTGGTGAAGAAGCAATACTAAAATAAAAGTTATAATAAATAATAAAAAATGC
CTAAATGATGGATTATTTCAATGATCCTTATTACTAAGTTCAAAATTAGAGTGAAAGTGG
CTCATTTACTGATATAGATGCAGTTTTTGGAGACGAATCGCTATCTTCTGGCTCTTCAGT
TCGATATGGTAACTCTTAACTATAAGCAGAAACTTTTGAGGATGAAAAAGAGCATTTTAT
AAGAATTTTATAGAAAAATATAAAAATGGGTGTGCTTTGTAGAATTCTTAGTGGAATTTA
AATTCACTTTATGAGAAAGAAAAGATACTGTTCTAAAGTTGATATATTCACAGATAATTA
TAATTCTATTTTTGAATGTTAAGTCAACTCTATAAAACTCAATAAAAATTCATCTTAATT
ATCATCATAGAAGTCATCAGTGCGCTATTCTCAAACTGGTTTTTATGAATAATTTAAAAC
ACTTGAAGATAATAAATAAGAAACTGAGCAAATAAAAGACTTTTAAAATGATAAATAATA
GAAAAGAGTGAAATTAAACATAAATAACCATTCTCTAAATGATTCATGTCATAATCAGAA
AAATACAATAATATATTCTAATAATCTTCAGAAAATGGAAGAAGAAAATAAAAACTAAGA
TATATTTATGAAATCTGAAAATATTTACAATAAATCTAATATAATATAACTTGATAAAAA
TAGCAGATAAAAATCTTACAGCTAAAACTAGTAAATTAATCTTAGGCAAGTCTCACTCTC
ATTAACAAATAATAATAACAAAAAAAAATCTTAAAAGTAGCAAGAAAATGATATTTTTTA
TGAGGTAAAAATTTTCTAATTTTCTGATGATTCTATCAAACAAAACTTGAATCATGCACC
TACATAACTTTTAGATAGTGATACTTTTGATCTCGTTAGAATGAGAGTATATGCACCTAC
AGTTTTTCATAGTCTGCAACAATCAGAAATTAATTTGATTTTAAATTAAGAAGACACTGA
TCCATATAAATAAAAACATAACATAGACATAGAAAATTCATTTAATATCTAGCTCAATAT
GACTTAAATAAAAAATGCTAGTGGATCAGATGGAGGAAAAAGTGGATAATTCTTTTTTTT
CTCCCATGATAACAAATTTTTGCTAAAAACATGCACAGAATAAGAGCTTAGAATTCTAAT
TGAAAGGCTACCTTCATATTTCCGATATTTAAAGGCAAATCCTAGAAGTTTAATAGCTAA
AATTTTCGGAGTATACTCATTTGAAGGTTTAAATGAAAAACCTATACACTTATTATTGAT
GAAAAATATAGCAGCATGTACAAAATAATTTATTGAAAGGACATATGATCTAAAAGGCTC
AACTTTCGATAGATAGGTTTTACCTAAGACTAAAAAAGAATCAGAATCCTTCTCAAGAGC
GCTAAATAGAATGATTCTAAAAGACCTAGATTTTATCAGCTTGGAAAAAAAAATATACAT
TTCGTTAGAAAATAGATTTTAGGTGTATAATTAACTTAAAAGAGATTCAGAATTTTTAAA
ATCATGTGGCTGGATAGACTACAGCTTGATTGTTTTCAAAATAAATAGAAAGAGGCATAC
AGAGTGGAAGGAATCAAACTAAGTAGCCTATTTAGAAGAAGAGGAAGATTTTGATGATTA
AATTTCTCATTATTACTAATTTGAATCTACAGAATAAAGTGGAATTTATTATCACATAGG
AATTATAGATTATCTATAGTTGTATGATATCTAAAAAGTATTAGAAAAGTGGGCAAAAAG
AATTATTCACTTTAGTCCAAGACTTGATACATCATCATAAGATCCTGAAACTTATAGTAA
AAGATTTATAAACTTTATGAAATAAATTTTTGAAATTTGA