Identifiers and Description

Gene Model Identifier

TTHERM_00474750

Standard Name

SEC23 (protein transport protein Sec23)

Aliases

PreTt02275 | 57.m00214 | 3709.m00074

Description

Sec23/Sec24 trunk domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00626 ) Gelsolin repeat
  • ( PF04810 ) Sec23/Sec24 zinc finger
  • ( PF04811 ) Sec23/Sec24 trunk domain
  • ( PF04815 ) Sec23/Sec24 helical domain
  • ( PF08033 ) Sec23/Sec24 beta-sandwich domain

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.8%

TetraMine Data

TTHERM_00474750

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_353010
Tetrahymena borealisEI9_13151.19.997093137033517e-262Sec23/Sec24 trunk domain-conta
ining protein (751 aa)
OxytrichaContig21712.0.g1089.997093137033517e-262Sec23/Sec24 trunk domain
SGDYPR181C9.997093137033517e-262SEC23 GTPase-activating protei
n, stimulates the GTPase activ
ity of Sar1p; component of the
Sec23p-Sec24p heterodimer of
the COPII vesicle coat, involv
ed in ER to Golgi transport
DictyBaseDDB_G02819851.0000509032773212e-171sec23 on chromosome: 3 positio
n 5216752 to 5219266
WormBaseWBGene000047542.9990837046884738e-127locus:sec-23 status:Confirme
d UniProt:Q9U2Z1 protein_i
d:CAB60476.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00474750(coding)
ATGATAGATATTTACGAAATAGAGTAAAAAGACGGTGTTAGATGTGTATGGAATAATATA
CCTCCTACTAAACTTGCAGCAACAAGGGCTGTTGTTCCAATTGGTATCCATTACACACCT
TATAAGGAATTAGATCCTAGCAATAGAATGGAATATGAAGCTTTACGTTGCAGATGCCAA
GCAATTTTGAATCCCTACTGCTAAGTTGATTTTAATCAAAAGTTCTGGATTTGCCCTTTT
TGTACTTCCAGAAATCCATTCCCTTAAATTTATCATCAAATTACTCCTTAAAATCTTCCT
GCAGAATTAATGGAAGACTATTCGACTATCGAATATGTTTATTCAAAGGAAAAGCCCGTT
CCAAATATCTTCTTATTAGTTGTTGATGTTAGTTTAGAATAGATTGAATTAGAAGCATTA
AGAGATTCTATTTAGCAATCATTGAATATTATTCCTCCTGATTCATATGTCGGTTTAATT
ACATTCGGAAAGTTTGTTTTTGTTCATGAATTAGGCTTTTAGGAGTGTCCTAAATCATAT
GCATTTAAAGGAAGCAAAGACTATACTACTACATAAGTTTAAGAAATGCTTGGTCTTATT
GCTCCTGGTACTTAGCCAAAGCCTGGAAAAAATATGGACGTTATTAAACGTTTCTTACTT
CCATTGAACGAATGTGAATTTACTTTAAATAGTATTCTTGATGATCTTCAACCTGATCCT
TGGAACGTTCCTTAAGGAGAAAGAGAATAGCGTGCTTCAGGCGTTGCTATCAATGCTGCT
ATCAGCTTAATTGAAGCTTGCCCTATCCCTGGCTCTAGAGTTATGTTCTTCACTGGTGGT
CCTTGCACTATTGGTCCAGGTTAAGTTTTTGGAATCAAGTAAGAGGAAACTCCTCGTTCT
TACTTGGATATCGGCCAAGATAATAGTATTGCTTAATACGTTAAAAAAGCAACTAAATAC
TATCAAACTCTTGCTCTTAGAGCTATAAAAAGCTAGATAACAGTAGATATTTATGGTTTT
TGCCCTGATCAATTTGGTTTGTACGAAATGAAATATATGGCAGAAAAGACTGGAGGTTAC
ATTGTTTTTAATGAAGAATTCAATTCAGATCCTTTCAGAGAAACATTTAGAAAAATATTT
GATAAGGATTAAAATGATGAATTAAGATTTGCATCAGCAGCTAGAATAGATATGTTTGTT
TGCAAGGAAGTTAAGATCTAAGGCGCTTTTGGTTCATGCTCTTCACTAAAGAAGGGTGGC
CCAATGGTTGCTGAAACTCCTATTGGTTAAGGTGGTACCACTCAATGGTATATTGGTGGT
ATGGATAGAAACTCAACATTGACTTTCATGCTAGATTTATCTGCTCACAACAAAGAATAA
AACTAAGCAAAGAGAGCTTTCTTCTAATTCTAAACAACTTACAAATCACCTTCTGGAGAG
ACAAAATTAAGAGTCACAACTTTCTTTAGAAAGTTTGCTGATCCTATAAGTAACTTTGAG
TTAGTTCAAGGTTTTGATTAAGAAGCTGCTTGTGTCTTAATGGCTCGTTTAGGTATTTAA
AAATCTGAATCTGAAGAGCCTATAGAAATTTTAAAATGGCTTGATAGAACCTTAATTAGG
TTTGTAACTCGTTTTGCTGAATATAAGCCAAATATAACTGATTCATTTAAATTACATGAT
AATTTAGCATTGTATCCTTAATTTATGTATCATTTAAGAAGAAGTCACTTCACTTAAATT
TTTGGTTTAAATCCTGATACAATCTCTTATTATCGTTGCACTTTTAATAGAGAAAATGTC
TCTAACTGTTAAGTTATGATTCAACCTGCTATATTCTCTTATTCAATTTAAAATCCAAGT
CCATCTCCTGTTAGTCTCGATGACACAGCTATGAGAAAAGACGTCATTTTATTGCTTGAT
AATTATTTCTAAGTTATTACTTGGTTAGGTCCTCAAATTAAATAATGGAAAGATAAGGAA
TATCATTTGGATCCCACTTATATTTCATTTAAGAACTTGTTAGATTCTCCAATGGAAGAT
GTTAAAGCTATTCTTGAAGATAGATTCCCTACTCCCATTTTTTATGAAACTTACGAAAAT
CATACAAAAGAAAGATATTTAAAATCAAGAATCAATCCTACAGGAAAAAATCAAGACCTT
ATAGATAGTGGTCATACATAAACTGATGATGCCTCATTAAACTAATTTATGGATCATTTA
ATAAAATTAGCTGTTTCCTAACCAAATAGTTGA


>TTHERM_00474750(protein)
MIDIYEIEQKDGVRCVWNNIPPTKLAATRAVVPIGIHYTPYKELDPSNRMEYEALRCRCQ
AILNPYCQVDFNQKFWICPFCTSRNPFPQIYHQITPQNLPAELMEDYSTIEYVYSKEKPV
PNIFLLVVDVSLEQIELEALRDSIQQSLNIIPPDSYVGLITFGKFVFVHELGFQECPKSY
AFKGSKDYTTTQVQEMLGLIAPGTQPKPGKNMDVIKRFLLPLNECEFTLNSILDDLQPDP
WNVPQGEREQRASGVAINAAISLIEACPIPGSRVMFFTGGPCTIGPGQVFGIKQEETPRS
YLDIGQDNSIAQYVKKATKYYQTLALRAIKSQITVDIYGFCPDQFGLYEMKYMAEKTGGY
IVFNEEFNSDPFRETFRKIFDKDQNDELRFASAARIDMFVCKEVKIQGAFGSCSSLKKGG
PMVAETPIGQGGTTQWYIGGMDRNSTLTFMLDLSAHNKEQNQAKRAFFQFQTTYKSPSGE
TKLRVTTFFRKFADPISNFELVQGFDQEAACVLMARLGIQKSESEEPIEILKWLDRTLIR
FVTRFAEYKPNITDSFKLHDNLALYPQFMYHLRRSHFTQIFGLNPDTISYYRCTFNRENV
SNCQVMIQPAIFSYSIQNPSPSPVSLDDTAMRKDVILLLDNYFQVITWLGPQIKQWKDKE
YHLDPTYISFKNLLDSPMEDVKAILEDRFPTPIFYETYENHTKERYLKSRINPTGKNQDL
IDSGHTQTDDASLNQFMDHLIKLAVSQPNS


>TTHERM_00474750(gene)
ATGATAGATATTTACGAAATAGAGTAAAAAGACGGTGTTAGATGTGTATGGAATAATATA
CCTCCTACTAAACTTGCAGCAACAAGGGCTGTTGTTCCAATTGGTATCCATTACACACCT
TATAAGGAATTAGATCCTAGCAATAGAATGGAATATGAAGCTTTACGTTGCAGATGCCAA
GCAATTTTGAATCCCTACTGCTAAGTTGATTTTAATCAAAAGTTCTGGATTTGCCCTTTT
TGTACTTCCAGAAATCCATTCCCTTAAATTTATCATCAAATTACTCCTTAAAATCTTCCT
GCAGAATTAATGGAAGACTATTCGACTATCGAATATGTATAAATATTTTTATTTAAAAAT
TGAATAATAACAGCTTCAAATTGTGAAATTAAACTTCAAGCAAAATAAATTTAAAACTAG
AATAAAATATTTTTCTTAATTTTTGATAAAATATTTAATAAAAAATATGTTTAAATTCTA
TTTTAAAAGAAATTTCTATCTTTTCTTAACAGTTTTTTAAGTTATCATTTAAAAATAAAA
ATAAAGGTTTATTCAAAGGAAAAGCCCGTTCCAAATATCTTCTTATTAGTTGTTGATGTT
AGTTTAGAATAGATTGAATTAGAAGCATTAAGAGATTCTATTTAGCAATCATTGAATATT
ATTCCTCCTGATTCATATGTCGGTTTAATTACATTCGGAAAGTTTGTTTTTGTTCATGAA
TTAGGCTTTTAGGAGTGTCCTAAATCATATGCATTTAAAGGAAGCAAAGACTATACTACT
ACATAAGTTTAAGAAATGCTTGGTCTTATTGCTCCTGGTACTTAGCCAAAGCCTGGAAAA
AATATGGACGTTATTAAACGTTTCTTACTTCCATTGAACGAATGTGAATTTACTTTAAAT
AGTATTCTTGATGATCTTCAACCTGATCCTTGGAACGTTCCTTAAGGAGAAAGAGAATAG
CGTGCTTCAGGCGTTGCTATCAATGCTGCTGTAATTATTTTATATTTTTCAATTATCAAA
TACACTTAAATACTAGCTTTTATTTCAATTAAATGTAAAAATAAGAAAAAAAATGTTTTT
AATAAATTCAAAGAAATATATTAATCTTATTTTAATATTTAATAGATCAGCTTAATTGAA
GCTTGCCCTATCCCTGGCTCTAGAGTTATGTTCTTCACTGGTGGTCCTTGCACTATTGGT
CCAGGTTAAGTTTTTGGAATCAAGTAAGAGGAAACTCCTCGTTCTTACTTGGATATCGGC
CAAGATAATAGTATTGCTTAATACGTTAAAAAAGCAACTAAATACTATCAAACTCTTGCT
CTTAGAGCTATAAAAAGCTAGATAACAGTAGATATTTATGGTTTTTGCCCTGATCAATTT
GGTTTGTACGAAATGAAATATATGGCAGAAAAGACTGGAGGTTACATTGTTTTTAATGAA
GAATTCAATTCAGATCCTTTCAGAGAAACATTTAGAAAAATATTTGATAAGGATTAAAAT
GATGAATTAAGATTTGCATCAGCAGCTAGAATAGATATGTTTGTTTGCAAGGAAGTTAAG
ATCTAAGGCGCTTTTGGTTCATGCTCTTCACTAAAGAAGGGTGGCCCAATGGTTGCTGAA
ACTCCTATTGGTTAAGGTGGTACCACTCAATGGTAATTTTTTTTATGCAATTTAAAATAA
GAAATTAATATTATTTTTTTTAGGTATATTGGTGGTATGGATAGAAACTCAACATTGACT
TTCATGCTAGATTTATCTGCTCACAACAAAGAATAAAACTAAGCAAAGAGAGCTTTCTTC
TAATTCTAAACAACTTACAAATCACCTTCTGGAGAGACAAAATTAAGAGTCACAACTTTC
TTTAGAAAGTTTGCTGATCCTATAAGTAACTTTGAGTTAGTTCAAGGTTTTGATTAAGAA
GCTGCTTGTGTCTTAATGGCTCGTTTAGGTATTTAAAAATCTGAATCTGAAGAGCCTATA
GAAATTTTAAAATGGCTTGATAGAACCTTAATTAGGTTTGTAACTCGTTTTGCTGAATAT
AAGCCAAATATAACTGATTCATTTAAATTACATGATAATTTAGCATTGTATCCTTAATTT
ATGTATCATTTAAGAAGAAGTCACTTCACTTAAATTTTTGGTTTAAATCCTGATACAATC
TCTTATTATCGTTGCACTTTTAATAGAGAAAATGTCTCTAACTGTTAAGTTATGATTCAA
CCTGCTATATTCTCTTATTCAATTTAAAATCCAAGTCCATCTCCTGTTAGTCTCGATGAC
ACAGCTATGAGAAAAGACGTCATTTTATTGCTTGATAATTATTTCTAAGTTATTACTTGG
TTAGGTCCTCAAATTAAATAATGGAAAGATAAGGAATATCATGTAAATAATTTAATAAAA
AATTCAAAAAATATTTATAAATTTTATTTTTAAATTAGTTGGATCCCACTTATATTTCAT
TTAAGAACTTGTTAGATTCTCCAATGGAAGATGTTAAAGCTATTCTTGAAGATAGATTCC
CTACTCCCATTTTTTATGAAACTTACGAAAATCATACAAAAGAAAGATATTTAAAATCAA
GAATCAATCCTACAGGAAAAAATCAAGACCTTATAGATAGTGGTCATACATAAACTGATG
ATGCCTCATTAAACTAATTTATGGATCATTTAATAAAATTAGCTGTTTCCTAACCAAATA
GTTGA