Identifiers and Description

Gene Model Identifier

TTHERM_00727840

Standard Name

SEC22 (protein transport protein sec22 )

Aliases

PreTt07285 | 118.m00113 | 3739.m00036

Description

protein transport protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00727840

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_17939.13.0011893800784333e-147hypothetical protein (231 aa)
OxytrichaContig16008.0.g303.998777993244535e-41Synaptobrevin
SGDYLR268W9.99946582325553e-18SEC22 R-SNARE protein; assembl
es into SNARE complex with Bet
1p, Bos1p and Sed5p; cycles be
tween the ER and Golgi complex
; involved in anterograde and
retrograde transport between t
he ER and Golgi; synaptobrevin
homolog
DictyBaseDDB_G02699420.000000000000001999258566166494DDB_G0269942 on chromosome: 1
position 3911017 to 3912100
WormBaseWBGene000188530.00000000000006002591555650462locus:sec-22 status:Confirme
d UniProt:Q94241 protein_i
d:CCD62869.1
Stentor CoeruleusSteCoe_158110.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00727840(coding)
ATGAATCAATCACATTCAATTTTTCAAACAACTATAGTTCGTGCATAAGATGGCTTAGTT
TTTTGCGAGTACACTACTGAAGGTGCTCATATTTAACCTGAGATATCAGGCTAGCTAAAA
AAATTCATTAAAAATGACTCTCTTTTCAAACAAAATTAAGATTTTAGGCTTGTTGAATTT
GGAAACTACACAATTGGTTATTTAGTTTAAGATGATGTCGTTTTTATAGCCTTGGTTAGC
TCTACTTATGATGTAAAGTTGTGCAGATAGTACGTTAAAGATATTTAATAGGGTTTCACA
GAAGAATTGAAAAATACTTTTGGTACAACAGGTGTTAATTATTATTCAAAGTTATCTACC
ATAGAAACTCCTTACAGTTTCATTAAATTTGATAGATATATCAAAAGAAAATGCAAAGAA
TTTTCTGATTAGAGATCTCAAGCAAATATAGATAGAATTAAAAACGATATGACAGATATC
CATGAAATCATGACACAAGTATTTTCTAAAGTCATGGACAGAACTAAAAACCTCAACGAG
TTAAACGAAAATGCTGCTGGATTAAAAGATTTTTCTAAGATTTATGTCAACAAAACCAAA
AACTTAGCATGGCAAATGTGGTTAAAAAAGAATGCAGTTTACTTTATTTTAATAATTTTA
TTATGTTTGTTTATATTATTTAAAATTATTTGA


>TTHERM_00727840(protein)
MNQSHSIFQTTIVRAQDGLVFCEYTTEGAHIQPEISGQLKKFIKNDSLFKQNQDFRLVEF
GNYTIGYLVQDDVVFIALVSSTYDVKLCRQYVKDIQQGFTEELKNTFGTTGVNYYSKLST
IETPYSFIKFDRYIKRKCKEFSDQRSQANIDRIKNDMTDIHEIMTQVFSKVMDRTKNLNE
LNENAAGLKDFSKIYVNKTKNLAWQMWLKKNAVYFILIILLCLFILFKII


>TTHERM_00727840(gene)
ATGAATCAATCACATTCAATTTTTCAAACAACTATAGGTAAAATAATACTTTATAAAATC
AATTTAATTAAGAGAAACATTAGATGCGTTTAAAAAACAAGAAATTTATATCTTTTATTT
TAAGCAAAATATTATTAACGTTTTTCAATTACATATCAAAAATAGTTCGTGCATAAGATG
GCTTAGTTTTTTGCGAGTACACTACTGAAGGTGCTCATATTTAACCTGAGATATCAGGCT
AGCTAAAAAAATTCATTAAAAATGACTCTCTTTTCAAACAAAATTAAGATTTTAGGCTTG
TTGAATTTGGAAACTACACAATTGGGTATATATTTATATATTATAAATAAATTTAAAAAA
GAATCAATATCCAGCAATAAATGAGAATCTTATTATTTTTTACAGTTATTTAGTTTAAGA
TGATGTCGTTTTTATAGCCTTGGTTAGCTCTACTTATGATGTAAAGTTGTGCAGATAGTA
CGTTAAAGATATTTAATAGGGTTTCACAGAAGTAATTAAATATATTTAGACATAATTACA
GCATTAATTTGGTTTAAATTAGTAAAAATTTATTTTTAAACAAACTCAAAATAGGAATTG
AAAAATACTTTTGGTACAACAGGTGTTAATTATTATTCAAAGTTATCTACCATAGAAACT
CCTTACAGTTTCATTAAATTTGGTAAAATTTATTATTTTATTTATTTTTAAATATGACAA
ATTAAAAAGAAGAAATATATATATCTTTGATCAGAAAATAGCAAATTAAATAAATAAATA
AACAAACAAACACCACCTTCAAAATTTATTTACAATAAACTTTTATTTTATAGATAGATA
TATCAAAAGAAAATGCAAAGAATTTTCTGATTAGAGATCTCAAGCAAATATAGATAGAAT
TAAAAACGATATGACAGATATCCATGAAATCATGACACAAGTATTTTCTAAAGTCATGGA
CAGAACTAAAAACCTCAACGGTATAAAAAATATTAATTTCATATACAAGCAAAAAATAAA
TTCTAATAGAATTTAGATTCTCAAATAATTTTATGAATTTGAAATGAAGAATAAAATAAT
TAAAATATACCTTCTTTAGACATTTTATTAATATTTAATCGATATATTTTTTAATTTATA
AAACTAGAGTTAAACGAAAATGCTGCTGGATTAAAAGATTTTTCTAAGATTGTAAATAAT
AATTATTTAATTTTTTAATATTTAATTTTTAATTATTTTAATTAATTTAATTAGTATGTC
AACAAAACCAAAAACTTAGCATGGCAAATGTGGTTAAAAAAGAATGCAGTTTACTTTATT
TTAATAATTTTATTATGTTTGTTTATATTATTTAAAATTATTTGA