Identifiers and Description

Gene Model Identifier

TTHERM_00188370

Standard Name

SEC145 (SECretory pathway (SEC14 homolog))

Aliases

PreTt08587 | 15.m00298 | 3697.m00010

Description

Putative phosphatidylinositol/phosphatidylcholine transfer protein; CRAL/TRIO domain containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.1%

TetraMine Data

TTHERM_00188370

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_06356.19.997093137033517e-262CRAL/TRIO domain-containing pr
otein (927 aa)
OxytrichaContig10262.0.g30.0000000000005000841553255702Ankyrin repeats (3 copies)
SGDYIR033W0.0000020007268868677913MGA2 ER membrane protein invol
ved in regulation of OLE1 tran
scription, acts with homolog S
pt23p; inactive ER form dimeri
zes and one subunit is then ac
tivated by ubiquitin/proteasom
e-dependent processing followe
d by nuclear targeting
WormBaseWBGene000040530.00010003404299092957locus:pme-5 Poly(ADP-ribose)
polymerase pme-5 status:Con
firmed UniProt:Q9TXQ1 prot
ein_id:CCD69564.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00188370(coding)
ATGCAAATGCAGAATATAAAGATAATATCACTCTAAAACGAGTAGTTAGATGAAAGGTAA
AGTTACACTTAAGTTAGCCTAAAATAAATATAGTTGTAGTAAAACTCAATAAATAATTTT
TCTCCTAAAAGCATAAATACCAAGTAAAACGGTAACTAATCTAAGAATAATACTCCCATA
AACAGCAAGTATAAATTAGATTCTTTTTCTAACATTTGCAATTAGCAGTAACAATCTATT
CAAAACAAAACAATATCTAATGGCAACTCTTAATAAAATACTCCCTCGGTCCGTAATGAA
AAAATTGGTAATTACAGAAAGCCTTCATAACTCTCTATAAATTCTTAAGATAAAACAACT
TTGTAAGGAATTACTCCTTCAGCTAAGCAAATTAAGGAGTATATTGACAAGAATTCAATT
ACTGGATTGCTTGGAGTTAGAAAACTAAAAAAATAAATGATAGACTCAAAAACTTTATCA
TAATTTTCTAGAATATAGAAGAATTTAGACAGTAAAGATCAAACTTAATAGGTATTTGAC
TAAATTTAGAAGAAAAAATAAATGTTGATGCAAAAAACTCAATAAAGTAGCACTTCAAAT
AACTAATTTAATACTAATTTTACTAATGGTGATGACTCTATGTATGATACTAACACCAAG
AAATATGAATATCTCTTAGATGTAGAAGTTCATAAAGCAGATATATTTTAAAAATGGGTG
CCATAGCAGCATTTGCAACAGCTATAAAAATAAAAAAGCCTTAATCCAGCAGTATTTTAA
TTAAATTTATCTTCTCTTAAGCGATAGTAAAACAACACTTAGACTGTGGCAAGTTAATAA
ACTATAAATAATACATCTTCATCCTAAAACCTTTCATCTAAAAGGAAAATCAAATACTTT
AAAGAGAATGTAGATAAAAGAAAAAGAAAGGAAATGAAAAAAGAAAATGAATCTCTACTT
AATAAAGAATTGCGTAGGTTTGGAAAATTTGTAGAATTTTCTAAAGTTGGACCTGCAAGA
AATATTACATGTCTTTAAACACGTATTGATTATCTATTCAATAAAATTCCTTCTGAATCA
GGATCAGCAAAGCAGCCTTTGTAAATATATTCATAAGGAACTCCTATAGGTTCTGATATA
ACTAAATGGAAACTTACTCGTCCTTAATCTTCAAACAGCTTTTTCGTTTCTTAGGTTGTG
TAAAAGAAATCTGTGGAAAGAGCATCCAAAATAGTTTAAAAATTAGATGTTTAAATAGAA
AATGACACAAGAGAGCAAAAAGAAAGAAATAATTACAACATACGCTCTAATTTAGATTCT
GTTGTTAAAAATATTAGATCCATTAATTTAAATTAATAAAATGCTTCTCTTAATAAAACG
AACATTTCAATTAGTTAATATTCTACAGTTAATACACCTAAATTAACTCTAGATTTTTAA
TCTCCCAGAGGATATTCTCCGTCAATTTCATTAGTTTCACCTTAAAGTACTATCAATAAT
AATAAAGATTTTTAAAGTCCCACTGGTGTATTTTTAAGACCTAATTCTAGTGTTGGTTTC
GCAAGAGATTTATAAAAAGATTCAATAAAAGAATAATTTAATACACATTCTTAGATAATA
AATAATGATCAAAATAACAAATAGTTGAATCAAAATTCTATTCAAAATAAATACTATTCA
TTACAGCAAACTCCCATAAAATACAATAAAGAAGACAGGCATAAAAAATCTAACTTCACA
TCTATCGGGTTAGAAGAATAAATACTAGAATAAGCTAATGAATAGGAATAGTTTAGCCCT
CCTAGAGGCAGTGTGTCAAACAGAGAAAGCAGAAGCCCTATCAAAATGAATAAAAATCTT
TACTCTAAATCTTATAACAACATAGAAATAACAAATTAAAGATTTACATAATAAGAACTA
AGGAGTAAGATAAATTCTTTTTATGAAAAAAATAAAACTTCAAATAAACATTCTAAGAAA
CCTTCTTCAATTAGCAGTTAGGTTGCTCTTTCTCTTTATTAGTAAGTTTAGGGTAATAAA
AAAAATCAAAAAATTGATATAAACTAACAATTAGATAGACAAGCAATTAATAAAGCTTTG
AAAGAACTCGATTAGGCAGAATATGACAATGACAAACTTATTTTTGATCCTAATTGCGAA
AGAATTAAAAGAAAGAGAAGACTTAAATAAAAACTAAGAAAACTACTAATAAAATGCGCT
AAAATGAATATTAAAGCAAAAGATATAAATACAGTTTCTATATTTAGCACAATTCCATAT
GAAAATAAAGGATCATTTGCATTTATAGAGGCTGTCAAAAAGGGATAAAATCAATAAGTT
ATATAACAGCTTGAAAAGAATATTTATTATGTCTCTGACTTTGACTAGTTTCATATGACA
GCTCTTCACCATGCTTGCAAAAAAGGAAATCTATTCCTTGCAAAATATTTAATATCCAAA
GGTGCAGAAATAGATGCCTAAGATTCTATGAAAAGAACTCCACTCTATTATGCTCTCATT
ACAGAAAACAAATAGCTGGTTAAAGAATTATTGCAATTAAAGTGCTCTCCATGGAGTGGA
GATTAATTTTCATTTTTAAAACAGAATTTGCCATAAGAAATCTTAAATATACTTTCATTT
GTTAAGAATTTGGATATAATATGCAAGTTATAATTCAACCTTTAAGAGAGAGAAAAAATA
TGGAAAAAAGAAATTGAAATCTTGAAGCTAATGTGA


>TTHERM_00188370(protein)
MQMQNIKIISLQNEQLDERQSYTQVSLKQIQLQQNSINNFSPKSINTKQNGNQSKNNTPI
NSKYKLDSFSNICNQQQQSIQNKTISNGNSQQNTPSVRNEKIGNYRKPSQLSINSQDKTT
LQGITPSAKQIKEYIDKNSITGLLGVRKLKKQMIDSKTLSQFSRIQKNLDSKDQTQQVFD
QIQKKKQMLMQKTQQSSTSNNQFNTNFTNGDDSMYDTNTKKYEYLLDVEVHKADIFQKWV
PQQHLQQLQKQKSLNPAVFQLNLSSLKRQQNNTQTVASQQTINNTSSSQNLSSKRKIKYF
KENVDKRKRKEMKKENESLLNKELRRFGKFVEFSKVGPARNITCLQTRIDYLFNKIPSES
GSAKQPLQIYSQGTPIGSDITKWKLTRPQSSNSFFVSQVVQKKSVERASKIVQKLDVQIE
NDTREQKERNNYNIRSNLDSVVKNIRSINLNQQNASLNKTNISISQYSTVNTPKLTLDFQ
SPRGYSPSISLVSPQSTINNNKDFQSPTGVFLRPNSSVGFARDLQKDSIKEQFNTHSQII
NNDQNNKQLNQNSIQNKYYSLQQTPIKYNKEDRHKKSNFTSIGLEEQILEQANEQEQFSP
PRGSVSNRESRSPIKMNKNLYSKSYNNIEITNQRFTQQELRSKINSFYEKNKTSNKHSKK
PSSISSQVALSLYQQVQGNKKNQKIDINQQLDRQAINKALKELDQAEYDNDKLIFDPNCE
RIKRKRRLKQKLRKLLIKCAKMNIKAKDINTVSIFSTIPYENKGSFAFIEAVKKGQNQQV
IQQLEKNIYYVSDFDQFHMTALHHACKKGNLFLAKYLISKGAEIDAQDSMKRTPLYYALI
TENKQLVKELLQLKCSPWSGDQFSFLKQNLPQEILNILSFVKNLDIICKLQFNLQEREKI
WKKEIEILKLM


>TTHERM_00188370(gene)
AATCTTAAAATTTGTTAATTAAAACAAAGAATGCAAATGCAGAATATAAAGATAATATCA
CTCTAAAACGAGTAGTTAGATGAAAGGTAAAGTTACACTTAAGTTAGCCTAAAATAAATA
TAGTTGTAGTAAAACTCAATAAATAATTTTTCTCCTAAAAGCATAAATACCAAGTAAAAC
GGTAACTAATCTAAGAATAATACTCCCATAAACAGCAAGTATAAATTAGATTCTTTTTCT
AACATTTGCAATTAGCAGTAACAATCTATTCAAAACAAAACAATATCTAATGGCAACTCT
TAATAAAATACTCCCTCGGTCCGTAATGAAAAAATTGGTAATTACAGAAAGCCTTCATAA
CTCTCTATAAATTCTTAAGATAAAACAACTTTGTAAGGAATTACTCCTTCAGCTAAGCAA
ATTAAGGAGTATATTGACAAGAATTCAATTACTGGATTGCTTGGAGTTAGAAAACTAAAA
AAATAAATGATAGACTCAAAAACTTTATCATAATTTTCTAGAATATAGAAGAATTTAGAC
AGTAAAGATCAAACTTAATAGGTATTTGACTAAATTTAGAAGAAAAAATAAATGTTGATG
CAAAAAACTCAATAAAGTAGCACTTCAAATAACTAATTTAATACTAATTTTACTAATGGT
GATGACTCTATGTATGATACTAACACCAAGAAATATGAATATCTCTTAGATGTAGAAGTT
CATAAAGCAGATATATTTTAAAAATGGGTGCCATAGCAGCATTTGCAACAGCTATAAAAA
TAAAAAAGCCTTAATCCAGCAGTATTTTAATTAAATTTATCTTCTCTTAAGCGATAGTAA
AACAACACTTAGACTGTGGCAAGTTAATAAACTATAAATAATACATCTTCATCCTAAAAC
CTTTCATCTAAAAGGAAAATCAAATACTTTAAAGAGAATGTAGATAAAAGAAAAAGAAAG
GAAATGAAAAAAGAAAATGAATCTCTACTTAATAAAGAATTGCGTAGGTTTGGAAAATTT
GTAGAATTTTCTAAAGTTGGACCTGCAAGAAATATTACATGTCTTTAAACACGTATTGAT
TATCTATTCAATAAAATTCCTTCTGAATCAGGATCAGCAAAGCAGCCTTTGTAAATATAT
TCATAAGGAACTCCTATAGGTTCTGATATAACTAAATGGAAACTTACTCGTCCTTAATCT
TCAAACAGCTTTTTCGTTTCTTAGGTTGTGTAAAAGAAATCTGTGGAAAGAGCATCCAAA
ATAGTTTAAAAATTAGATGTTTAAATAGAAAATGACACAAGAGAGCAAAAAGAAAGAAAT
AATTACAACATACGCTCTAATTTAGATTCTGTTGTTAAAAATATTAGATCCATTAATTTA
AATTAATAAAATGCTTCTCTTAATAAAACGAACATTTCAATTAGTTAATATTCTACAGTT
AATACACCTAAATTAACTCTAGATTTTTAATCTCCCAGAGGATATTCTCCGTCAATTTCA
TTAGTTTCACCTTAAAGTACTATCAATAATAATAAAGATTTTTAAAGTCCCACTGGTGTA
TTTTTAAGACCTAATTCTAGTGTTGGTTTCGCAAGAGATTTATAAAAAGATTCAATAAAA
GAATAATTTAATACACATTCTTAGATAATAAATAATGATCAAAATAACAAATAGTTGAAT
CAAAATTCTATTCAAAATAAATACTATTCATTACAGCAAACTCCCATAAAATACAATAAA
GAAGACAGGCATAAAAAATCTAACTTCACATCTGTAAATTAAATTTAAAGGCATTTATTT
ATTTTTTTAATTTAATTTTTTTAATTAGATCGGGTTAGAAGAATAAATACTAGAATAAGC
TAATGAATAGGAATAGTTTAGCCCTCCTAGAGGCAGTGTGTCAAACAGAGAAAGCAGAAG
CCCTATCAAAATGAATAAAAATCTTTACTCTAAATCTTATAACAACATAGAAATAACAAA
TTAAAGATTTACATAATAAGAACTAAGGAGTAAGATAAATTCTTTTTATGAAAAAAATAA
AACTTCAAATAAACATTCTAAGAAACCTTCTTCAATTAGCAGTTAGGTTGCTCTTTCTCT
TTATTAGTAAGTTTAGGGTAATAAAAAAAATCAAAAAATTGATATAAACTAACAATTAGA
TAGACAAGCAATTAATAAAGCTTTGAAAGAACTCGATTAGGCAGAATATGACAATGACAA
ACTTATTTTTGATCCTAATTGCGAAAGAATTAAAAGAAAGAGAAGACTTAAATAAAAACT
AAGAAAACTACTAATAAAATGCGCTAAAATGAATATTAAAGCAAAAGATGTATGAACATA
ATTTGCTCATATTTTTCTATTATAATTTTTTTATTAAAATAAATATAGATAAATACAGTT
TCTATATTTAGCACAATTCCATATGAAAATAAAGGATCATTTGCATTTATAGAGGCTGTC
AAAAAGGGATAAAATCAATAAGTTATATAACAGCTTGAAAAGAATATTTATTATGTCTCT
GACTTTGACTAGGTAATTTAACTGATCTTATATTAACTCTCTCTTAAAAATATTTATAAA
TAGTTTCATATGACAGCTCTTCACCATGCTTGCAAAAAAGGAAATCTATTCCTTGCAAAA
TATTTAATATCCAAAGGTGCAGAAATAGATGCCTAAGATTCTATGAAAAGAACTCCACTC
TATTATGCTCTCATTACAGAAAACAAATAGCTGGTTAAAGTAAAATAACATGAAGTTTTT
TTTAAAATTTAAATATTTTTAATAAAATAGGAATTATTGCAATTAAAGTGCTCTCCATGG
AGTGGAGATTAATTTTCATTTTTAAAACAGAATTTGCCATAAGAAATCTTAAATATACTT
TCATTTGTTAAGAATTTGGATATAATATGCAAGTTATAATTCAACCTTTAAGAGAGAGAA
AAAATATGGAAAAAAGAAATTGAAATCTTGAAGCTAATGTGA