Identifiers and Description

Gene Model Identifier

TTHERM_00494848

Standard Name

SEC144 (SECretory pathway (SEC14 homolog))

Aliases

3711.m01001

Description

Putative phosphatidylinositol/phosphatidylcholine transfer protein; SEC14 cytosolic factor, putative

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00494848

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_13075.13.998688523634227e-123SEC14 cytosolic factor (744 aa
)
OxytrichaContig20661.0.g899.004005705510192e-49CRAL/TRIO domain
SGDYMR079W4.000054831110256e-33SEC14 Phosphatidylinositol/pho
sphatidylcholine transfer prot
ein; involved in regulating Pt
dIns, PtdCho, and ceramide met
abolism, products of which reg
ulate intracellular transport
and UPR; functionally homologo
us to mammalian PITPs
Stentor CoeruleusSteCoe_71221.4251640827409352e-21
WormBaseWBGene000119624.0002685161515803e-16CRAL-TRIO domain-containing pr
otein T23G5.2 status:Confirm
ed UniProt:Q03606 protein_
id:CAJ76964.1
DictyBaseDDB_G02700220.000000000040005666873964816DDB_G0270022 on chromosome: 1
position 4041315 to 4042649

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00494848(protein)
MKTNQLCQIDIPKNQYSINAPSNQHYNYKYLKEKILPGLTPINSPDLSPQISLNQIEDPA
FANIKMLKIDQESKNNFSMNQFSQLRYGSRVIHKEQHKAEFDNLNNCEAENDEKEQQTGI
VHVSNYHKKQTEAKKSEDLASELQGFEQEVYGTSNKSTESKFSVLQKFSTTNNNKLEFQD
NSLEFYNINETQKKKVMELKSIIAQKIETNTLQQKIFKKFDNFTILKFLNARDGSIKDGC
QMFIDFLQWRIDNQVENINEFQFQEYDQVQNVYPHGFHGYDNEGRPIWIENLGKLKLKEL
MKITNEERLKKYFIQNFEYLVNEVFPACSKMFQKPIYQYIIILDMKDHNLSLNDLKSFLN
MTSNITKNNYPEILYKMYIVNTSSLFSFLWKGVKYILNEKTRLKVEILSNQFLKSVNGKI
KIENIPLFLGGSCQHCVQIQKEIDKNQKYLSKKICSLQSN


>TTHERM_00494848(coding)
ATGAAAACAAATTAGCTTTGTCAAATTGATATTCCTAAAAATTAATATTCAATTAATGCG
CCATCAAACTAACACTATAATTATAAATATCTAAAGGAAAAAATTCTACCTGGCCTTACT
CCTATAAACTCTCCTGATTTATCACCTTAGATATCATTAAATTAGATAGAAGATCCAGCA
TTTGCAAATATTAAAATGCTAAAAATTGATTAAGAAAGTAAGAATAATTTTTCTATGAAC
TAATTTTCTCAATTAAGATATGGCAGCAGAGTTATACATAAAGAACAACATAAGGCTGAG
TTTGATAATCTAAATAATTGTGAGGCAGAAAACGATGAGAAAGAGTAATAAACAGGTATT
GTACATGTTTCTAATTACCATAAAAAATAAACTGAAGCCAAAAAATCAGAAGACCTTGCT
TCAGAGCTATAAGGATTTGAATAAGAAGTGTATGGTACAAGCAACAAATCTACTGAATCA
AAATTTAGTGTTTTACAAAAATTTAGTACAACCAATAATAATAAATTAGAATTTCAAGAC
AATTCTTTAGAGTTTTACAATATAAATGAAACCTAAAAGAAAAAAGTTATGGAATTAAAA
AGTATTATTGCTTAAAAAATAGAAACAAACACTTTATAACAGAAAATATTCAAAAAATTT
GATAATTTTACTATTTTAAAATTTTTGAATGCAAGAGATGGATCGATAAAGGATGGTTGC
TAGATGTTTATAGATTTTTTATAATGGAGAATAGATAATTAAGTTGAAAATATTAACGAA
TTTTAGTTTTAGGAGTACGATTAAGTTTAGAATGTTTACCCTCACGGATTCCATGGGTAT
GATAATGAAGGAAGACCAATTTGGATTGAAAATTTAGGAAAGTTAAAATTAAAAGAGTTG
ATGAAAATAACGAATGAAGAAAGGTTGAAAAAATACTTTATTTAAAATTTTGAGTATCTA
GTAAATGAAGTATTTCCTGCTTGTAGTAAAATGTTTTAAAAGCCAATTTACTAATATATC
ATAATACTTGATATGAAAGATCACAATTTAAGCTTGAATGATCTTAAAAGTTTTTTGAAT
ATGACATCGAATATCACAAAAAATAACTATCCAGAAATACTATATAAAATGTACATTGTT
AATACAAGCTCTTTGTTTTCTTTTCTTTGGAAAGGTGTCAAATATATTTTGAATGAAAAA
ACAAGACTCAAAGTTGAGATTTTAAGTAATTAATTTTTAAAATCTGTAAATGGAAAGATT
AAAATAGAAAACATTCCTTTGTTTTTAGGTGGATCTTGCTAACACTGTGTCTAGATACAA
AAGGAAATAGATAAAAATTAAAAGTATTTATCTAAAAAGATATGTAGCTTGTAATCAAAT
TGA


>TTHERM_00494848(gene)
ATGAAAACAAATTAGCTTTGTCAAATTGATATTCCTAAAAATTAATATTCAATTAATGCG
CCATCAAACTAACACTATAATTATAAATATCTAAAGGAAAAAATTCTACCTGGCCTTACT
CCTATAAACTCTCCTGATTTATCACCTTAGATATCATTAAATTAGATAGAAGATCCAGCA
TTTGCAAATATTAAAATGCTAAAAATTGATTAAGAAAGTAAGAATAATTTTTCTATGAAC
TAATTTTCTCAATTAAGATATGGCAGCAGAGTTATACATAAAGAACAACATAAGGCTGAG
TTTGATAATCTAAATAATTGTGAGGTTCTGCTAACTATTATAAAAAATTTATACAAAATA
TTCAACACCCTTAAAATAATAGGCAGAAAACGATGAGAAAGAGTAATAAACAGGTATTGT
ACATGTTTCTAATTACCATAAAAAATAAACTGAAGCCAAAAAATCAGAAGACCTTGCTTC
AGAGCTATAAGGATTTGAATAAGAAGTGTATGGTACAAGCAACAAATCTACTGAATCAAA
ATTTAGTGTTTTACAAAAATTTAGTACAACCAATAATAATAAATTAGAATTTCAAGACAA
TTCTTTAGAGTTTTACAATATGTAAATTATCTTATCTTTTTTTTACACATAAAGTTTATG
GAAATTAAATTAAGTTGAATTTTATTAAACTATGACAAATAATAATTAATCATAATTTAC
CAATAATTTAATAGATTTAGGATTTAATTAATAGCTATGCTATGATAATGTTTTATTGTG
ATTTAAAAAATAATAAATATTTATCTAAAAGCTGGGTTACTTTTAAATAATTTGTTGAAA
ATTTAATATATTTTTTTTAAAAGTTGATTTTATTTTTATTTTGGAGTGATAAAAATAAAT
TTGAAAAAACATTAATCAAAAAAAATAATTTTAAAGTTTTTTTATCTAAAAAATAGAAAT
GAAACCTAAAAGAAAAAAGTTATGGAATTAAAAAGTATTATTGCTTAAAAAATAGAAACA
AACACTTTATAACAGAAAATATTCAAAAAATTTGATAATTTTACTATTTTAAAATTTTTG
AATGCAAGAGATGGATCGATAAAGGATGGTTGCTAGATGTTTATAGATTTTTTATAATGG
AGAATAGATAATTAAGTTGAAAATATTAACGTAATTAAAAATAAAGTATTTTATTTTACT
AATTAAATTTATTTATTAGGAATTTTAGTTTTAGGAGTACGATTAAGTTTAGAATGTTTA
CCCTCACGGATTCCATGGGTATGATAATGAAGGAAGACCAATTTGGATTGAAAATTTAGG
AAAGTTAAAATTAAAAGAGTTGATGAAAATAACGAATGAAGAAAGGTTGAAAAAATACTT
TATTTAAAATTTTGAGTATCTAGTAAATGAAGTATTTCCTGCTTGTAGTAAAATGTTTTA
AAAGCCAATTTACTAATATATCATAATACTTGATATGAAAGATCACAATTTAAGCTTGAA
TGATCTTAAAAGTTTTTTGAATATGACATCGAATATCACAAAAAATAACTATCCAGAAAT
ACTATATAAGTAAATTAATATATTAAACCAGTAAAAAAATAAGATATATTTTAAAAAAAT
AAATATAAAGAATGTACATTGTTAATACAAGCTCTTTGTTTTCTTTTCTTTGGAAAGGTG
TCAAATATATTTTGAATGAAAAAACAAGACTCAAAGTTGAGATTTTAAGTAATTAATTTT
TAAAATCTGTAAATGGAAAGGTAAAATTAGTAATAAGTCTTCATTAATGATTGTAATTTT
TTAAGATTAAAATAGAAAACATTCCTTTGTTTTTAGGTGGATCTTGCTAACACTGTGTCT
AGATACAAAAGGAAATAGATAAAAATTAAAAGTATTTATCTAAAAAGATATGTAGCTTGT
AATCAAATTGA