Identifiers and Description

Gene Model Identifier

TTHERM_01068300

Standard Name

SEC143 (SECretory pathway (SEC14 homolog))

Aliases

PreTt08142 | 217.m00055

Description

Putative phosphatidylinositol/phosphatidylcholine transfer protein; CRAL/TRIO, N-terminus family protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 11.5%

TetraMine Data

TTHERM_01068300

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02973.19.997093137033517e-262CRAL/TRIO, family protein (414
aa)
OxytrichaContig20661.0.g895.999140071902665e-66CRAL/TRIO domain
SGDYMR079W2.000214949834694e-50SEC14 Phosphatidylinositol/pho
sphatidylcholine transfer prot
ein; involved in regulating Pt
dIns, PtdCho, and ceramide met
abolism, products of which reg
ulate intracellular transport
and UPR; functionally homologo
us to mammalian PITPs
Stentor CoeruleusSteCoe_186081.603810890548638e-28
WormBaseWBGene000119629.003625457657353e-25CRAL-TRIO domain-containing pr
otein T23G5.2 status:Confirm
ed UniProt:Q03606 protein_
id:CAJ76964.1
DictyBaseDDB_G02691823.998609120989657e-17rsc5 on chromosome: 1 position
3809035 to 3810441

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01068300(coding)
ATGGGTTGCGTCGATAGCAGATCTTAATAAAATGATGTAAAAACAGCTCCTACTCCTTAA
AGCATGTTGCATAGAATGGAGTTATTGACCTCTGCAACAACTTTACAAAGCGAGAGTGAC
CAAGAAACAGTTTTTAACAAAGAATTAGATAGATTTTTGTTTTACTTCAATCAAAGCAGC
ATCATAAAAAATGAAGCATATTAGAAGAATATTTAAGAAATGAATAGATTAAGGCATGAA
AACAACCTGGATTCCTAATTTTTTAATAATTAATATCTTTATAGATTTATGAAAGCAAGA
CATTTTGATATGTAAAAATCAATAAAGATGTTTAAAGATCACCTACATTGGCGTAAAGAA
AACAAAGTAGACACAATTTTGAAAGATTTCGTTTTTTGGGAGTCAGATGAAGTCTAAGAG
ATTTATCCTCATGGTTATCACAAAACAGATAAAGAAGGAAGGCCAATTTATATAGAAATA
TTTAAAAACGTAACATTTAACGATCTCTACAACCTTACAACATAAGAAAGAATGAAAAAA
CATTACTACTAAAATTATGAATAGCTTATTAATAAAATGCTTCCCTGTGCCTCTATAGCT
GCAAATAAATATGTAGGTTAAACCTTGACTATTCTTGATGCAAAAGATATGAAACTTAAA
CCTATGGAAGCCAAAAACTTTGTCTAACTAGTGACTAGTTTTTCTGAATCTAATTACCCT
GAAATCATGGGAAAGTTATATGTTGTTAATAGTCCTTTGTTGGCATAAGTTTTCTGGAAG
GTTATATCTGTTATGCTAAATGAAACTATTAAAAGTAAGATTTGCATTCTTGGAAAAGAT
TACAAGCAAAAGTTACTTGAAAATATTGACAAGGAGAATTTACCAGAATTTTTAGGTGGA
GAGTCAGACACTCAAAATGGAGCACTTCTTCGTAAAAATATAGGTCCTTGGAATGATTTT
GGCAAAAAAATAATGTTCCCTCATGAAGATGAAAGAATATTGAGAAATATTACTTAAGAA
GAAAAAGATTAACTAAAACAAGATATTTTCAATTTTAAAAATAAAAGACAATCTGTATAA
GAGAGAGCTAGTCAGAGAAATTCTGTAAATTAAAGATAATCTATCATAAAGATATAATAA
AATGAGGCTAACAACTCTTTAAATAAAAGTGCTAATGATAATATTAAAAATATTGACTAT
AGCATCAATATACTTGACAATTTAGAGAAAGAATAAATTCCAAAATGA


>TTHERM_01068300(protein)
MGCVDSRSQQNDVKTAPTPQSMLHRMELLTSATTLQSESDQETVFNKELDRFLFYFNQSS
IIKNEAYQKNIQEMNRLRHENNLDSQFFNNQYLYRFMKARHFDMQKSIKMFKDHLHWRKE
NKVDTILKDFVFWESDEVQEIYPHGYHKTDKEGRPIYIEIFKNVTFNDLYNLTTQERMKK
HYYQNYEQLINKMLPCASIAANKYVGQTLTILDAKDMKLKPMEAKNFVQLVTSFSESNYP
EIMGKLYVVNSPLLAQVFWKVISVMLNETIKSKICILGKDYKQKLLENIDKENLPEFLGG
ESDTQNGALLRKNIGPWNDFGKKIMFPHEDERILRNITQEEKDQLKQDIFNFKNKRQSVQ
ERASQRNSVNQRQSIIKIQQNEANNSLNKSANDNIKNIDYSINILDNLEKEQIPK


>TTHERM_01068300(gene)
ATGGGTTGCGTCGATAGCAGATCTTAATAAAATGATGTAAAAACAGCTCCTACTCCTTAA
AGCATGTTGCATAGAATGGAGTTATTGACCTCTGCAACAACTTTACAAAGCGAGAGTGAC
CAAGAAACAGTTTTTAACAAAGAATTAGATAGATTTTTGTAAGAATATTCTGCGAATAAT
AGATAATTATTTTTAAGCAATTTGGTAGAGTTTTATAAATAGCTAATTCATTTTAAAAAA
GGTTTTACTTCAATCAAAGCAGCATCATAAAAAATGAAGCATATTAGAAGAATATTTAAG
AAATGAATAGATTAAGGCATGAAAACAACCTGGATTCCTAATTTTTTAATAATTAATATC
TTTATAGATTTATGAAAGCAAGACATTTTGATATGTAAAAATCAATAAAGATGTTTAAAG
ATCACCTACATTGGCGTAAAGAAAACAAAGTAGACACAATTTTGAAAGTAAATTGATTCA
TTTAGTGGAGTTGAATTTTATTCGTTCTTTTTTTTATTTTAGGATTTCGTTTTTTGGGAG
TCAGATGAAGTCTAAGAGATTTATCCTCATGGTTATCACAAAACAGATAAAGAAGTAAAG
ATTTCTATTGATTATTTATTTATTTAATCGAATTTAAATTAAAATTGCACTTGGATTAAA
ATAGGGAAGGCCAATTTATATAGAAATATTTAAAAACGTAACATTTAACGATCTCTACAA
CCTTACAACATAAGAAAGAATGAAAAAACATTACTACTAAAATTATGAATAGCTTATTAA
TAAAATGCTTCCCTGTGCCTCTATAGCTGCAAATAAATATGTAGGTTAAACCTTGACTAT
TCTTGATGCAAAAGATATGAAACTTAAACCTATGGAAGCCAAAAACTTTGTCTAACTAGT
GACTAGTTTTTCTGAATCTAATTACCCTGAAATCATGGGAAAGTAATTTATTAGATAATA
AATATTCTATTCAAATTTAATTTTTTCTTAGGTTATATGTTGTTAATAGTCCTTTGTTGG
CATAAGTTTTCTGGAAGGTTATATCTGTTATGCTAAATGAAACTATTAAAAGTAAGATTT
GCATTCTTGGAAAAGATTACAAGCAAAAGTTACTTGAAAATGTAATAAAATTTTTTAAAA
ATTAAAAAGTGAAATTTTTTGAGCTATTTTAGATTTATTGTGATTAATTCTGATTGAAGA
TAATCAATATATTTTTAAATAAAATAAATTTATTTCACATTCAAAATTATTTTTCTATAT
TTTAAGATTGACAAGGAGAATTTACCAGAATTTTTAGGTGGAGAGTCAGACACTCAAAAT
GGAGCACTTCTTCGTAAAAATATAGGTCCTTGGAATGATTTTGGCAAAAAAATGTATTTT
AATTTGATCAAAAAATGTTATTTTCTACTTATAAAATTTGATTTCTTTTAGAATTTCCTT
TATTAAAATGGATAACTTAATAAATAATTAGAATGTTCCCTCATGAAGATGAAAGAATAT
TGAGAAATATTACTTAAGAAGAAAAAGATTAACTAAAACAAGATATTTTCAATTTTAAAA
ATAAAAGACAATCTGTATAAGAGAGAGCTAGTCAGAGAAATTCTGTAAATTAAAGATAAT
CTATCATAAAGATATAATAAAATGAGGCTAACAACTCTTTAAATAAAAGTGCTAATGATA
ATATTAAAAATATTGACTATAGCATCAATATACTTGACAATTTAGAGAAAGAATAAATTC
CAAAATGA