Identifiers and Description

Gene Model Identifier

TTHERM_00285520

Standard Name

SEC142 (SECretory pathway (SEC14 homolog))

Aliases

PreTt25881 | 26.m00233 | 3688.m00029

Description

Putative phosphatidylinositol/phosphatidylcholine transfer protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF07813 ) LTXXQ motif
  • ( PF00650 ) CRAL/TRIO domain
  • ( PF07819 ) PGAP1-like protein
  • ( PF03765 ) CRAL/TRIO, N-terminus
  • ( PF05057 ) putative serine esterase (DUF676)
  • ( PF08555 ) Eukaryotic family of unknown function
  • ( TIGR01639 ) Plasmodium falciparum uncharacterized domain TIGR01639

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00285520

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_09262.19.997093137033517e-262hypothetical protein (783 aa)
OxytrichaContig15931.0.g469.995516318087232e-125Putative serine esterase (DUF6
76)
Stentor CoeruleusSteCoe_74483.4811068399043105e-57
DictyBaseDDB_G02788696.002397656030775e-43DDB_G0278869 on chromosome: 3
position 1313132 to 1316635
WormBaseWBGene000156356.001249495680822e-29status:Partially_confirmed U
niProt:H2KYM6 protein_id:CCD
63891.1
SGDYGL144C0.000000009000371344152433ROG1 Protein with putative ser
ine active lipase domain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00285520(coding)
ATGAGTTTTAAAGCATAGCTAGAAGTACTTGTTCACATGGAAAGTTTTAGGAATATCAAC
ATTTATCATTAAGGGATATATGTGATGAGAGCTAGAATATTTCAAAGACTTGAGGATGGA
ACAACTATTAACGCACATCCTTACAGAATTGTTGAATTTGATTCGAGTTTGATTAGAGAA
AAAATGAAATAAAAGTACAAATTAAATTCTGATTTATATGATTGCTATTTCTTTTCAAAA
GGATTTGTCATTAAATATATGGATGAAATGGTAGATTTAGATGATATTTGCCATTTTAGA
GCAGAAATAGATTCTTATCCACATTATAATGAAGATAATTTCTTTTTTACTGTTGACCTT
ATGTTTGCTGATCTTTCTTCTCAAACATAAGAAAATGTTTCACTCAATGATCCAGATAAA
GCAGCTTTTAAAGTTGTAGGAACTTTTGAAAGTCTTTTACATAATTCATTCAAAGGTATT
AGAGAATATGTTCCTGTCTACTTTGGAGATCTATATTACTCCTAAGTGAATCTTACTGTG
CATACTGCACTTATTAACTATTAATTTAGATATCTTCCTCCTAGAATCACAGAGAATGAA
AAATCAAAGAAATAAAACCACAATTAAGTTTAAAATCCAGAAAATTTTGATTAGTTTTTT
AGCATTATAACAGATAACTTTAAACCAAGTTAAGTTGATGAAATTTATAATACATATGTT
GGATCTCTTAGATTTGATCACAAGAAGTTTCTTAAACACTTCAAGGAGTTAGCTTAAAAA
ATGATTAAAAATGAGTTCAAGCTTTAAGAGATATATCTAAAAATTCAAGAACCTGCTATC
CCCGAATATCTTTAGCTTTATTGGTAGAGCTAAAATTAGCCAAATAATTAAGCTATGGAA
AAAAAACAAGAGGATTCAATTAATTCTGATAGAATAGCTTCAGAGATGTCAGTATCAGAA
GACAATGAAGAGATGAAAGGAGATGATGAAACTACCATACCACAAGATGAAACAGAATTA
AGTATATAAATGACAACTTTCAAGGATACTTCATTTTAAATTGATAAAAAATCCTACTAT
AATTCATTCTACGACATCACTAGAATTCCGATAAGCAAATTTTTTGATTTGAGTAAATAG
GAAACAAGAAAGCAGCTTGTTAATGAAATCTAAAAAGAAATAAATGATATGGCTGGTTGT
CAATTTTTACTCTGGAATTAATATGTTGAATTGCTCCGTTTAAATACAATTAAGTTTACT
AAACTGCTTCTTGATGAGTATTAATATAAAATAAATGATTAATGGGGTCAGAGTATATTT
AGATACCCAGTAGTGATTAAAGAATATTACAACTACAGCGAATAAAGAAGTGCTAAATAA
AATATAAAACAAGCAAAAAAATATAGAAAAACTACTTGCTTTAAAAACAGAGAACCTTTA
AATATAGAGGATTTAAATCTTTTTCCCAAAGCTAAATTCCATCCTATCATCTTCCACGAA
GTGTATACTAAAAACAAAGAAATTAATTTGGACACATCTTCTTATGAGCCTTTGAGGAGA
GACGAAGCACATGTGGTTGTCCTTGTCCATGGTTTCTAGGGAAGTTCCTACGATCTTAAA
CTATTCAGTAACAATATAACAATAAAGCATCCAGATGCAATATTTTTGCATAGCTCTTGC
AACGAGGAGTACACAGATGGTGATATAGAAGTTATGGGTATCAGACTTGCAGATGAAGTT
GGAAAATTTTTAAGTTCTTAACTATATGGAAGAAAATTAAAAAGGCTATCATTTGTTGGT
CACTCATTAGGTGGATTGATTCTTAGATCTGCACTGCGTCACTTGACCATGTACTAGGAG
TTCTTTTTTACTTTTATAACATTCTCTACTCCACATTTGGGCTTTTTGTTCAGCTAAAGT
AAAATGGTTGATGCAGGTCTTTGGTTTATGAAAGCTTGGAATAAATCAGAAAGTTTAAAG
CAAATGACTTTAGCAGATAAAAAAAATTTAAGAGAGACCTTCATTTATTAATTAGCAAAA
CAAACAGACCTTAGTAAATTTAAGAATATAATACTCTTTAGCTCTCCTTAAGATCAATAT
GTCCCTTATCATTCAGCTAGGATGCAGTAAACAACAAAATAACATAGTGATTCAAAATAA
TCTGAAGTATATGATGAGATGCTGAAAGAGATATTTGGTAGAATAACACTTGATAGAATC
CATAGAGTAGATGTATCTTTTGAAATACCTGGAAAGGTTTTGGATAATTTTATTGGAAGA
GCTGCTCATATTTAATTTTTAGAAAACGAAGCTTTAATGAAAATGATTCTATCTGATTTT
AAAAATATATTTATATGA


>TTHERM_00285520(protein)
MSFKAQLEVLVHMESFRNINIYHQGIYVMRARIFQRLEDGTTINAHPYRIVEFDSSLIRE
KMKQKYKLNSDLYDCYFFSKGFVIKYMDEMVDLDDICHFRAEIDSYPHYNEDNFFFTVDL
MFADLSSQTQENVSLNDPDKAAFKVVGTFESLLHNSFKGIREYVPVYFGDLYYSQVNLTV
HTALINYQFRYLPPRITENEKSKKQNHNQVQNPENFDQFFSIITDNFKPSQVDEIYNTYV
GSLRFDHKKFLKHFKELAQKMIKNEFKLQEIYLKIQEPAIPEYLQLYWQSQNQPNNQAME
KKQEDSINSDRIASEMSVSEDNEEMKGDDETTIPQDETELSIQMTTFKDTSFQIDKKSYY
NSFYDITRIPISKFFDLSKQETRKQLVNEIQKEINDMAGCQFLLWNQYVELLRLNTIKFT
KLLLDEYQYKINDQWGQSIFRYPVVIKEYYNYSEQRSAKQNIKQAKKYRKTTCFKNREPL
NIEDLNLFPKAKFHPIIFHEVYTKNKEINLDTSSYEPLRRDEAHVVVLVHGFQGSSYDLK
LFSNNITIKHPDAIFLHSSCNEEYTDGDIEVMGIRLADEVGKFLSSQLYGRKLKRLSFVG
HSLGGLILRSALRHLTMYQEFFFTFITFSTPHLGFLFSQSKMVDAGLWFMKAWNKSESLK
QMTLADKKNLRETFIYQLAKQTDLSKFKNIILFSSPQDQYVPYHSARMQQTTKQHSDSKQ
SEVYDEMLKEIFGRITLDRIHRVDVSFEIPGKVLDNFIGRAAHIQFLENEALMKMILSDF
KNIFI


>TTHERM_00285520(gene)
AAAAAATTGTTAATTTAAATATCATTCATTGAAAGTAAAAAAAAAAATAAATAAATACAT
ATCTGATTTAGCATAATATAAGTAAATAGCAGCCAAAATGAGTTTTAAAGCATAGCTAGA
AGTACTTGTTCACATGGAAAGTTTTAGGAATATCAACATTTATCATTAAGGGATATATGT
GATGAGAGCTAGAATATTTCAAAGACTTGAGGATGTAAATTTTCCTCTTTTTTAAGACTT
TTTATGATTAAAATCAAATTATTGCAAATTTTATATTGAGAAAATGTAAAATGATGTAAA
AGATAAAACGAAATATTATTAATAAAAGGGAACAACTATTAACGCACATCCTTACAGAAT
TGTTGAATTTGATTCGAGTTTGATTAGAGAAAAAATGAAATAAAAGTACAAATTAAATTC
TGATTTATATGATTGCTATTTCTTTTCAAAAGGATTTGTCATTAAATATATGGATGAAAT
GGTAGATTTAGATGATATTTGCCATTTTAGAGCAGAAATAGATTCTTATCCACATTATAA
TGAAGATAATTTCTTTTTTACTGTTGACCTTATGTTTGCTGATCTTTCTTCTCAAACATA
AGAAAATGTTTCACTCAATGTAAATCAATATTTTATTTGTTCATTGATAGATAGATACAT
AGATAGATAAATAAATAAATATATTTGAAGCAGCTTATATTCTAAAATAAAATTAAATAG
GATCCAGATAAAGCAGCTTTTAAAGTTGTAGGAACTTTTGAAAGTCTTTTACATAATTCA
TTCAAAGGTAATTTATTTTAATTACTTATTCGAAAGGAATTTAACATTTATGCTCTTACT
GATATCAATTAGGTATTAGAGAATATGTTCCTGTCTACTTTGGAGATCTATATTACTCCT
AAGTGAATCTTACTGTGCATACTGCACTTATTAGTAATATAATTTGCTAAATGAAGTCCA
CTTATATCCTTATTAATATTATAAGACTATTAATTTAGATATCTTCCTCCTAGAATCACA
GAGAATGAAAAATCAAAGAAATAAAACCACAATTAAGTTTAAAATCCAGAAAATTTTGAT
TAGTTTTTTAGCATTATAACAGATAACTGTAAATATTTTAGTACTAGAAACTATTTAATT
GTTTATTTTAATAAATTACTTAAAAACAGTTAAACCAAGTTAAGTTGATGAAATTTATAA
TACATATGTTGGATCTCTTAGATTTGATCACAAGAAGTTTCTTAAACACTTCAAGGAGTT
AGCTTAAAAAATGATTAAAAATGAGTTCAAGCTTTAAGAGATATATCTAAAAGTATAATT
ATTTTTAAAATATTTCGTAAATTGAGAGCTGTTTAATTTGAAGAATTGTATTAATAAAAT
AGATTCAAGAACCTGCTATCCCCGAATATCTTTAGCTTTATTGGTAGAGCTAAAATTAGC
CAAATAATTAAGCTATGGAAAAAAAACAAGAGGATTCAATTAATTCTGATAGAATAGCTT
CAGAGATGTCAGTATCAGAAGACAATGAAGAGATGAAAGGAGATGATGAAACTACCATAC
CACAAGATGAAACAGAATTAAGTATATAAATGACAACTTTCAAGGATACTTCATTTTAAA
TTGATAAAAAATCCTACTATAATTCATTCTACGACATCACTAGAATTCCGATAAGCAAAT
TTTTTGATTTGAGTAAATAGGAAACAAGAAAGCAGCTTGTTAATGAAATCTAAAAAGTAA
AGCAAAAAAATATTTTTCGCTTAAAAAAAATTTTTAAATTCATTATGAAAATTTTATTAA
ATTAAAAAAAACAGACTTTGTTTGTGATAAGTTTAAGCTAATTTATTTAATAATAATAAT
AATTTTATTTTAGGAAATAAATGATATGGCTGGTTGTCAATTTTTACTCTGGAATTAATA
TGTTGAATTGCTCCGTTTAAATACAATTAAGTTTACTAAACTGCTTCTTGATGAGTATTA
ATATAAAATAAATGATTAATGGGGTCAGAGTATATTTAGATACCCAGTAGTGATTAAAGA
ATATTACAACTACAGCGAATAAAGAAGTGCTAAATAAAATATAAAACAAGCAAAAAAATA
TAGAAAAACTACTTGCTTTAAAAACAGAGAACCTTTAAATATAGAGGATTTAAATCTTTT
TCCCAAAGCTAAATTCCATCCTATCATCTTCCACGAAGTGTATACTAAAAACAAAGAAAT
TAATTTGGACACATCTTCTTATGAGCCTTTGAGGAGAGAGTAATTAAATATTATGGATTA
ATTTAGGTCTATTCCTATTTAAAAAAATTTTTTAATATAATTTACAGCGAAGCACATGTG
GTTGTCCTTGTCCATGGTTTCTAGGGAAGTTCCTACGATCTTAAACTATTCAGTAACAAT
ATAACAATAAAGCATCCAGATGCAATATTTTTGCATAGCTCTTGCAACGAGGAGTACACA
GATGGTGATATAGAAGTTATGGGTATCAGACTTGCAGATGAAGTTGGAAAATTTTTAAGT
TCTTAACTATATGGAAGAAAATTAAAAAGGTAAGTTGTGAAAATTAATATTTTGTTTGAA
ATATAAATATATTTTAAAAGGCTATCATTTGTTGGTCACTCATTAGGTGGATTGATTCTT
AGATCTGCACTGCGTCACTTGACCATGTACTAGGAGTTCTTTTTTACTTTTATAACATTC
TCTACTCCACATTTGGGCTTTTTGTTCAGCTAAAGTAAAATGGTTGATGCAGGTAAATTA
AAAAAAATAAACTAATTTTAATTATATAAATATTAATTTATTTATTTAATAAAAGGTCTT
TGGTTTATGAAAGCTTGGAATAAATCAGAAAGTTTAAAGCAAATGACTTTAGCAGATAAA
AAAAATTTAAGAGAGACCTTCATTTATTAATTAGCAAAACAAACAGTAATAGCATTTATT
TAAAAATAGTATTTAAAATTAACATATTATAAATTAGGACCTTAGTAAATTTAAGAATAT
AATACTCTTTAGCTCTCCTTAAGATCAATATGTCCCTTATCATTCAGCTAGGATGCAGTA
AACAACAAAATAACATAGTGATTCAAAGTAACTCAAACAAATAATTTATTTTTGATTTCT
AAAAAATACTCTATAATTTAATTTAGATAATCTGAAGTATATGATGAGATGCTGAAAGAG
ATATTTGGTAGAATAACACTTGATAGAATCCATAGAGTAGATGTATCTTTTGAAATACCT
GGAAAGTAAATTAAAAGTTTCTTCAAAAATAAAATTCTAATGAAAAAACAATACATCTTT
ATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTATTTTATATTTAGGGT
TTTGGATAATTTTATTGGAAGAGCTGCTCATATTTAATTTTTAGAAAACGAAGCTTTAAT
GAAAATGATTCTATCTGATTTTAAAAATATATTTATATGAAATTATCTTTGTTTTATTCA
TTAAATAAATAATTAAATTAAGATTATATATAATTAAAAATGATAATTCAATTAATTTTG
CAGCTATTTTTTAATTAAAAAAAACATAAGAAATATTCTAATAAATGATTTGAT