Identifiers and Description

Gene Model Identifier

TTHERM_01093560

Standard Name

SEC11 (SECretory)

Aliases

PreTt16929 | 230.m00038 | 3806.m00219

Description

signal peptidase I family protein; SECretory

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_01093560

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_20571.17.002107388768227e-120signal peptidase I family prot
ein (185 aa)
OxytrichaContig19588.0.1.g535.001369568193564e-73Peptidase S24-like
WormBaseWBGene000218442.0001081030036656e-67status:Confirmed UniProt:Q9N
3D0 protein_id:CCD72991.1
DictyBaseDDB_G02763592.9994376937714457e-52sec11 on chromosome: 2 positio
n 6742578 to 6743421
SGDYIR022W5.999907735769095e-44SEC11 18kDa catalytic subunit
of the Signal Peptidase Comple
x (SPC; Spc1p, Spc2p, Spc3p, a
nd Sec11p) which cleaves the s
ignal sequence of proteins tar
geted to the endoplasmic retic
ulum
Stentor CoeruleusSteCoe_17453.221340285992516e-27

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_01093560(coding)
ATGGTTTTGTCGATAGTTAAAGATACAATCAAAGAAATAGCTAGCATGAAATTTAGAAAA
ATTCTAATTTAGGGAGCTAGTTTGGCTATGATTGTTGGATCTGCTTTGATGATTTGGAAA
ACATTAATGGTACTTACAATGAGTGATTCTCCTGTAGTCGTAGTACTTACAGGTAGTATG
GAACCTTTATACTATAGAGGTGATATCCTTTTCTTGTATAACAGAGAAGAAAAGATTACT
ACAGGTGATGTCGTAGTTTATCAAAATGGAGAATAAGAAATTCCAATTGTTCACAGGGTT
ATTGCTGTTTAAGAAAAAGAAGATAACGAATATTATATTTTAACAAAGGGTGATAACAAT
TTTAGTGACGATAGAGGTCTCTATTCACCTCCTAAGTTATGGATCCATAAAAAAGATGTC
TTAGGTAAAGTAAAAGGCTACTTACCTTATCTCGGAATGGTAACAATTATTTTAAATGAT
TACCCTACAGTTAAGTATGTAGTTTTAGGTTTGATGGGATTATTTGTTTTAATCGCTAAG
GATCCTTAAAGCTGA


>TTHERM_01093560(protein)
MVLSIVKDTIKEIASMKFRKILIQGASLAMIVGSALMIWKTLMVLTMSDSPVVVVLTGSM
EPLYYRGDILFLYNREEKITTGDVVVYQNGEQEIPIVHRVIAVQEKEDNEYYILTKGDNN
FSDDRGLYSPPKLWIHKKDVLGKVKGYLPYLGMVTIILNDYPTVKYVVLGLMGLFVLIAK
DPQS


>TTHERM_01093560(gene)
ATGGTTTTGTCGATAGTTAAAGATACAATCAAAGAAATAGCTAGCATGAAATTTAGAAAA
ATTCTAATTTAGGGAGCTAGTTTGGCTATGATTGTTGGATCTGCTTTGATGATTTGGAAA
ACATTAATGGTACTTACAATGAGTGATTCTCCTGTAGTCGTAGTACTTACAGGTAGTATG
GAACCTTTATACTATAGAGGTGATATCCTTTTCTTGTATAACAGAGAAGAAAAGATTACT
ACAGGTGATGTCGTAGTTTATCAAAATGGAGAATAAGAAATTCCAATTGTTCACAGGGTT
ATTGCTGTTTAAGAAAAAGAAGATAACGAATATTATATTTTAACAAAGGGTGATAACAAT
TTTAGTGACGATAGAGGTCTCTATTCACCTCCTAAGTTATGGATCCATAAAAAAGATGTC
TTAGGTAAAGTAAAAGGCTACTTACCTTATCTCGGAATGGTAACAATTATTTTAAATGAT
TACCCTACAGTTAAGTATGTAGTTTTAGGTTTGATGGGATTATTTGTTTTAATCGCTAAG
GATCCTTAAAGCTGA