Identifiers and Description

Gene Model Identifier

TTHERM_00355870

Standard Name

SEC1 (SECretory )

Aliases

PreTt27573 | 37.m00290 | 3836.m02379

Description

Sm-like protein involved in docking and fusion of exocytic vesicles

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00355870

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_02246.19.997093137033517e-262Sec1 family protein (804 aa)
OxytrichaContig226.0.g461.9996410647472548e-29Sec1 family
DictyBaseDDB_G02839373.000555717977434e-27sec1 on chromosome: 4 position
1335851 to 1337901
WormBaseWBGene000067573.9983110956465888e-22locus:unc-18 Putative acetyl
choline regulator unc-18 sta
tus:Confirmed UniProt:P34815
protein_id:CCD67914.1
SGDYDR164C0.000000000000006000101554955223SEC1 Sm-like protein involved
in docking and fusion of exocy
tic vesicles; binds to assembl
ed SNARE complexes at the memb
rane and stimulates membrane f
usion; localization to sites o
f secretion (bud neck and bud
tip) is dependent on SNARE fun
ction
Stentor CoeruleusSteCoe_51480.00000000003775134544279098

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00355870(coding)
ATGCAAATACTACAAAAACTAAATGAGAATATCAGTTAGTATTCCCTGAAAGAAAATGTT
TTCTACAGGTTTTAAGAAATGTTTGATGATGTAAGAAGCAGATACCCAAATATAGGAACA
TTTATTCTTGTTGTAGATTAGCAAAGTTTAAAACTGCTTTCTTCAGCACTTAAAATGGCA
GATTTAATAAAAATGGGTGTTTCTTCAATTGAAAAGCTGGAGTTAAAAAGAAAAGAACAT
CCAAATACGCATGCCATTTACTTACTTTCACCTAGTAAAGAATCGATAAGTCTACTTATA
TCTGACTTTGAGGGACAGGTTTTGTAACTTAAAAACACTGATGAAAAGAAAAAGAAGAAA
GCATAGAAGCAAAAGGAAAAGGAAAAGAAGAAGAAGAAGAAAAAAGGTAAACAGGACGAT
GATGATGAAGACGAATAAGAAGATGATGAAGATGATGATGAAGTTATTGAAGAAAATGAA
GAAAGCAAAAAGAAGAGGAAACAAGATGAATTAGAACCTAAAAAACCAGAGAAAAAAAAG
GATTTGCAACCACCAGAAATATAATATGCTAGAGTTCATATTTTCTTTATGAATAAGCTA
CCAAAATACTTGCTCGAAGAAATGGGAAAGTCTGAAAAGTTAGTCAAAAGAATTAGAACC
ATGAAAGAATTTAATCATTCTTTCTTTTTCTTCGAATAAAACGGATTTCATCTACATTTA
GAGTAATCTTTACCAATTCTTTTTTCTAAGAAGGAAAGCTAAGAGGCAAGAATAATGTTT
GAATGCATTTCTGATCAATTATCTACAGTTCTACCTGCTCTATTGAGGTTTGATAAGATA
AATATATTATACAATAACTAAAATCAAAGCAGTCCAAGCTATTTGTTTGCCAACTATTTT
GAAAAAAAATTGCAGGAAATGATTTTGAAATTGAAGGAAAGTGAGTCTCCATACATCGAT
CCAACATCAGGAGAGATTTACTTGATTATAGTTGACAGAGGTATAGATCCCGTCACACCT
CTTTTGCATGATTATTCTTACTAGAGCATGATTTATGATTTATTAGAAGTCGATACAGAA
AAAAATATAGTTGAGTATGAAAAAATAGAACTCAAAAAAGAAAACAAAGCAAGTGAATCT
ACAAAAGAAGTAAAAAAATATAAATAATAGCTAAGTGATCATAAGGATGAAGTTTTTGCA
AAGTTTAGATATCAAAACATCACTGAAGCTTTGAAAGGAATCAGAGATGATTTTGAAAAA
CACACAGAAAATATGTAGAGAGCAAAGTCTTCTCAAAATTAAGTTAGGAGTATTGAAGAT
GTTAACAAAATTATTGGAGAGTTTCCAGAATACAATGAACTTTTATAAAAATATGCAGTG
CATTTTGACTTGATTTTAAAATGTTTCAATACCTTTTAAAAATATAATTTGCAATTAAAC
TGTGAGCTTGAGTAATCTATGGTAACTGGAATTGATGATCTTGCAAAACCTATTAAAAGT
GATACTATTATTCAAAGTATATAAGATATATTAAATAGAAAAGATATAAAAAGCACAGAT
AGACTTAGGATAGCAATGATTGCTTTTATAACATGTGATCTCCAATAAGACTAAAGACAA
AAAATTTTAAATCTATTTGAATTAAGTGAATAAAAATAATTAAAAAACTTAGCATGGCTT
GGTATCTAATTTAGTGATGATAAAAATTCTACTTTTAGTAGAGTTAATTAACAAATTATA
GATTTATCTAAGGAGTAGTATAATGCTTATTTGAATAAATAAAAAAATTGCTAAGAATGT
AAGAAAATACGTGCAGATGCAAAAAAATCAAAGAAAGGAGGAAATTCTGAAGAGGACTAA
AAGCGAGATTGTGATGAATGTGGTTAGTTGTATTTCGTCTTTAGCGTTATGAGGCACACT
CCTCTATCAGCTATAGCTATACATTCTGCAATCAAATAAATAATTAAATCATACGATGTT
TCAAAGGATGCATTAAATAGTTTAGGGTTTGGGATAAAATAAGTTGGATAAGTTAATAGA
CCTATATCTCCACTTAAAGAATAGCCACTATTGAATGAAGAAAGTGAGATGTAATCTGAA
AATAAATTGCAATCAACAAATTCAAGTAAACAAGTAAAATCATCTAAAAAGAAAGATAAA
GACAAAAAAAAAGACAAAGAAGAATCTAAATCATAAAAAAAAGAAAAAGGTGATTTGCAT
TTACCCAATGAATATGAAGCATTTTTGTAATAATCAGAGAGTGAAGACTCAGATGCTCTC
AAAAAAAGTAAAAAAATAATTGCTTTCTTTATTGGTGGAATCAGTTATGCAGAAATTAGA
GCTATCAGAAAATTCTAGGATGAATATTAGAGTAATCCAGTAATAATAGGAGCAACTCAC
TTGCTTACCCATCGCAACTACATAGAAGAGATAGACCAAATGTCAACTTTTGCTTGA


>TTHERM_00355870(protein)
MQILQKLNENISQYSLKENVFYRFQEMFDDVRSRYPNIGTFILVVDQQSLKLLSSALKMA
DLIKMGVSSIEKLELKRKEHPNTHAIYLLSPSKESISLLISDFEGQVLQLKNTDEKKKKK
AQKQKEKEKKKKKKKGKQDDDDEDEQEDDEDDDEVIEENEESKKKRKQDELEPKKPEKKK
DLQPPEIQYARVHIFFMNKLPKYLLEEMGKSEKLVKRIRTMKEFNHSFFFFEQNGFHLHL
EQSLPILFSKKESQEARIMFECISDQLSTVLPALLRFDKINILYNNQNQSSPSYLFANYF
EKKLQEMILKLKESESPYIDPTSGEIYLIIVDRGIDPVTPLLHDYSYQSMIYDLLEVDTE
KNIVEYEKIELKKENKASESTKEVKKYKQQLSDHKDEVFAKFRYQNITEALKGIRDDFEK
HTENMQRAKSSQNQVRSIEDVNKIIGEFPEYNELLQKYAVHFDLILKCFNTFQKYNLQLN
CELEQSMVTGIDDLAKPIKSDTIIQSIQDILNRKDIKSTDRLRIAMIAFITCDLQQDQRQ
KILNLFELSEQKQLKNLAWLGIQFSDDKNSTFSRVNQQIIDLSKEQYNAYLNKQKNCQEC
KKIRADAKKSKKGGNSEEDQKRDCDECGQLYFVFSVMRHTPLSAIAIHSAIKQIIKSYDV
SKDALNSLGFGIKQVGQVNRPISPLKEQPLLNEESEMQSENKLQSTNSSKQVKSSKKKDK
DKKKDKEESKSQKKEKGDLHLPNEYEAFLQQSESEDSDALKKSKKIIAFFIGGISYAEIR
AIRKFQDEYQSNPVIIGATHLLTHRNYIEEIDQMSTFA


>TTHERM_00355870(gene)
ATGCAAATACTACAAAAACTAAATGAGAATATCAGTTAGTATTCCCTGAAAGAAAATGTT
TTCTACAGGTTTTAAGAAATGTTTGATGATGTAAGAAGCAGATACCCAAATATAGGAACA
TTTATTCTTGTTGTAGATTAGCAAAGTTTAAAACTGCTTTCTTCAGCACTTAAAATGGCA
GATTTAATAAAAATGGGTGTTTCTTCAATTGAAAAGCTGGAGTTAAAAAGAAAAGAACAT
CCAAATACGCATGCCATTTACTTACTTTCACCTAGTAAAGAATCGATAAGTCTACTTATA
TCTGACTTTGAGGGACAGGTTTTGTAACTTAAAAACACTGATGAAAAGAAAAAGAAGAAA
GCATAGAAGCAAAAGGAAAAGGAAAAGAAGAAGAAGAAGAAAAAAGGTAAACAGGACGAT
GATGATGAAGACGAATAAGAAGATGATGAAGATGATGATGAAGTTATTGAAGAAAATGAA
GAAAGCAAAAAGAAGAGGAAACAAGATGAATTAGAACCTAAAAAACCAGAGAAAAAAAAG
GATTTGCAACCACCAGAAATATAATATGCTAGAGTTCATATTTTCTTTATGAATAAGCTA
CCAAAATACTTGCTCGAAGAAATGGGAAAGTCTGAAAAGTTAGTCAAAAGAATTAGAACC
ATGAAAGAATTTAATCATTCTTTCTTTTTCTTCGAATAAAACGGATTTCATCTACATTTA
GAGTAATCTTTACCAATTCTTTTTTCTAAGAAGGAAAGCTAAGAGGCAAGAATAATGTTT
GAATGCATTTCTGATCAATTATCTACAGTTCTACCTGCTCTATTGAGGTTTGATAAGATA
AATATATTATACAATAACTAAAATCAAAGCAGTCCAAGCTATTTGTTTGCCAACTATTTT
GAAAAAAAATTGCAGGAAATGATTTTGAAATTGAAGGAAAGTGAGTCTCCATACATCGAT
CCAACATCAGGAGAGATTTACTTGATTATAGTTGACAGAGGTATAGATCCCGTCACACCT
CTTTTGCATGATTATTCTTACTAGAGCATGATTTATGATTTATTAGAAGTCGATACAGAA
AAAAATATAGTTGAGTATGAAAAAATAGAACTCAAAAAAGAAAACAAAGCAAGTGAATCT
ACAAAAGAAGTAAAAAAATATAAATAATAGCTAAGTGATCATAAGGATGAAGTTTTTGCA
AAGTTTAGATATCAAAACATCACTGAAGCTTTGAAAGGAATCAGAGATGATTTTGAAAAA
CACACAGAAAATATGTAGAGAGCAAAGTCTTCTCAAAATTAAGTTAGGAGTATTGAAGAT
GTTAACAAAATTATTGGAGAGTTTCCAGAATACAATGAACTTTTATAAAAATATGCAGTG
CATTTTGACTTGATTTTAAAATGTTTCAATACCTTTTAAAAATATAATTTGCAATTAAAC
TGTGAGCTTGAGTAATCTATGGTAACTGGAATTGATGATCTTGCAAAACCTATTAAAAGT
GATACTATTATTCAAAGTATATAAGATATATTAAATAGAAAAGATATAAAAAGCACAGAT
AGACTTAGGATAGCAATGATTGCTTTTATAACATGTGATCTCCAATAAGACTAAAGACAA
AAAATTTTAAATCTATTTGAATTAAGTGAATAAAAATAATTAAAAAACTTAGCATGGCTT
GGTATCTAATTTAGTGATGATAAAAATTCTACTTTTAGTAGAGTTAATTAACAAATTATA
GATTTATCTAAGGAGTAGTATAATGCTTATTTGAATAAATAAAAAAATTGCTAAGAATGT
AAGAAAATACGTGCAGATGCAAAAAAATCAAAGAAAGGAGGAAATTCTGAAGAGGACTAA
AAGCGAGATTGTGATGAATGTGGTTAGTTGTATTTCGTCTTTAGCGTTATGAGGCACACT
CCTCTATCAGCTATAGCTATACATTCTGCAATCAAATAAATAATTAAATCATACGATGTT
TCAAAGGATGCATTAAATAGTTTAGGGTTTGGGATAAAATAAGTTGGATAAGTTAATAGA
CCTATATCTCCACTTAAAGAATAGCCACTATTGAATGAAGAAAGTGAGATGTAATCTGAA
AATAAATTGCAATCAACAAATTCAAGTAAACAAGTAAAATCATCTAAAAAGAAAGATAAA
GACAAAAAAAAAGACAAAGAAGAATCTAAATCATAAAAAAAAGAAAAAGGTGATTTGCAT
TTACCCAATGAATATGAAGCATTTTTGTAATAATCAGAGAGTGAAGACTCAGATGCTCTC
AAAAAAAGTAAAAAAATAATTGCTTTCTTTATTGGTGGAATCAGTTATGCAGAAATTAGA
GCTATCAGAAAATTCTAGGATGAATATTAGAGTAATCCAGTAATAATAGGAGCAACTCAC
TTGCTTACCCATCGCAACTACATAGAAGAGATAGACCAAATGTCAACTTTTGCTTGA