Identifiers and Description

Gene Model Identifier

TTHERM_00047080

Standard Name

SDH1 (Succinate DeHydrogenase)

Aliases

PreTt11187 | 3.m01828 | 3824.m02946

Description

succinate dehydrogenase [ubiquinone] flavoprotein subunit; succinate dehydrogenase- flavoprotein subunit containing protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.2%

TetraMine Data

TTHERM_00047080

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Stentor CoeruleusSteCoe_347540
WormBaseWBGene000153919.997093137033517e-262locus:sdha-1 Succinate dehyd
rogenase [ubiquinone] flavopro
tein subunit, mitochondrial
status:Confirmed UniProt:Q09
508 protein_id:CCD62793.1
Tetrahymena borealisEI9_01749.19.997093137033517e-262succinate dehydrogenase, flavo
protein subunit containing pro
tein (637 aa)
DictyBaseDDB_G02805359.997093137033517e-262sdhA on chromosome: 3 position
3543819 to 3545699
OxytrichaContig18065.0.g819.997093137033517e-262FAD binding domain
SGDYKL148C9.997093137033517e-262SDH1 Flavoprotein subunit of s
uccinate dehydrogenase (Sdh1p,
Sdh2p, Sdh3p, Sdh4p), which c
ouples the oxidation of succin
ate to the transfer of electro
ns to ubiquinone as part of th
e TCA cycle and the mitochondr
ial respiratory chain

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00047080(coding)
ATGTTTAAATACTTATCTAAGATATAAAGAGTTACCTTACACAGCAAAGTTTCAAAGAAT
TTTGCAGTTTTGTCAAAGGATCATCCCGAAAAGGGACCTTCCCAAGGTCATTTGACTGAC
AAATACACTGTCATTGATCACACCTATGATGCTATCGTTGTTGGTGCTGGTGGTGCTGGT
TTAAGAGCTGCTTTTGGTTTGGTTGAAGAAGGTTTCAAGACCGCTTGTATTACTAAGCTT
TTCCCTACTCGTTCTCACACAGTCGCTGCTTAAGGTGGTATTAACGCTGCTTTAGGTAAT
ATGACAGAAGATGACTGGAAATGGCATTTTTATGATACAGTTAAGGGTTCTGATTGGTTA
GGTGATTAAGATGCTATCTAATATATGACTAGAGAAGCTCCCGCTGCCGTCTTAGAATTA
GAATCTTACGGTCTTCCCTTCTCTCGTACTCCTGAAGGCAAGATCTATCAAAGAGCCTTC
GGTGGTCAATCCCTCAAGTTCGGCAAGGGTGGTTAGGCAAGAAGAACTGCTTGTGCAGCT
GATAGAACTGGACATGCTATGTTACATACTTTATTCGGAAGATCCTTAGCTTATAATTGC
AATTTCTTTATTGAATATTTCGTTATTGACTTAATTATGGATGAAGAAGGTGCCTGCAGA
GGTGTCATCTGTATGTCTATGGCTGATGGTTCTATTCACAGAATCAGAGCCCATTACACT
GTATTGGCTGCTGGTGGTTACGGTAGATCTTATCTTTCTTGCACTGCTGCTCACACCTGC
ACTGGTGATGGTATGGCTCTTGCTACTAGAGCTGGACTTCCTCTTGAAGATCCTGAATTC
GTTTAATTCCATCCTACTGGTATCTACGGTTCTGGTTGTTTGATGACCGAAGGTTGCAGA
GGTGAAGGTGGTATCCTTGTTAACAGTAATGGTGAAGCTTTCATGGAAAAATATGCTCCC
ACTGCTAAGGATCTTGCTTCCAGAGATGTCGTCTCTAGAGCTATGACTATTGAAATCCTT
GAAGGTAGAGGTGTTGGCCCTAAGAAGGATCACATTTTCTTATAATTACATCACTTGAGT
CCTGAAACTTTACATTAGAGATTACCTGGTATTTCTGAAACTGCCAGAATTTTCGCAGGT
GTTGATGTTACCAAAGAACCAGCTCCTGTCGTTCCTACCGTTCACTACAATATGGGTGGT
GTTCCCACTAACTGGAAGACTGAAGTTATTACCCAAGACAAGAATGGAAAGGACAAGATT
GTTCCTGGTTTGCTTGCTGCTGGTGAAAACGCTTGTGCTTCTGTCCACGGTGCTAACAGA
CTTGGTGCTAACTCTCTTTTAGATATTGTCGTTTTCGGTAGAGCTGCTGCCAAACTTGTT
AAGGAAAAGCTTAAACCTGGTACTCCTCATAAGGATTTACCCAAGAATGCTGGTGAATAA
GCTTTAGCCAGATTAGATAAATACAGATTTGCTAATGGTGAATACACTACTCACCACGTT
AGAACTGCTATGTAAGAAACCATGTAACGTCACGCAGCTGTCTTCAGAATTGAAAAGCTT
ATGGCTGAAGGTGTTCAAAAATTAGATCACATTTATGAATAATCAAAGAGCCTTAAAACC
TTCGACAGAGGTCTTGTTTGGAACACTGATCTCATTGAAACCTTAGAATTAGAAAACCTT
CTTTTATGCTCTAAATAAACTCTTCTCGCTGGTTTACTCAGAAAGGAATCCAGAGGTGCT
CACGCCAGAGACGATTTTAAGGAAAGAGATGATAAGAATTGGATGAAGCACAGTCTCACT
TGGATTAAAGATGTAAATACTGGTAAAACTGAAGTAACCTATAGAGATGTCATCAACCAC
ACTCTTGATAGTGAAGTTACTCCTGTTCCTCCCGCTAAAAGATCATATTGA


>TTHERM_00047080(protein)
MFKYLSKIQRVTLHSKVSKNFAVLSKDHPEKGPSQGHLTDKYTVIDHTYDAIVVGAGGAG
LRAAFGLVEEGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWKWHFYDTVKGSDWL
GDQDAIQYMTREAPAAVLELESYGLPFSRTPEGKIYQRAFGGQSLKFGKGGQARRTACAA
DRTGHAMLHTLFGRSLAYNCNFFIEYFVIDLIMDEEGACRGVICMSMADGSIHRIRAHYT
VLAAGGYGRSYLSCTAAHTCTGDGMALATRAGLPLEDPEFVQFHPTGIYGSGCLMTEGCR
GEGGILVNSNGEAFMEKYAPTAKDLASRDVVSRAMTIEILEGRGVGPKKDHIFLQLHHLS
PETLHQRLPGISETARIFAGVDVTKEPAPVVPTVHYNMGGVPTNWKTEVITQDKNGKDKI
VPGLLAAGENACASVHGANRLGANSLLDIVVFGRAAAKLVKEKLKPGTPHKDLPKNAGEQ
ALARLDKYRFANGEYTTHHVRTAMQETMQRHAAVFRIEKLMAEGVQKLDHIYEQSKSLKT
FDRGLVWNTDLIETLELENLLLCSKQTLLAGLLRKESRGAHARDDFKERDDKNWMKHSLT
WIKDVNTGKTEVTYRDVINHTLDSEVTPVPPAKRSY


>TTHERM_00047080(gene)
ATGTTTAAATACTTATCTAAGATATAAAGAGTTACCTTACACAGCAAAGTTTCAAAGAAT
TTTGCAGTTTTGTCAAAGGATCATCCCGAAAAGGGACCTTCCCAAGTATGCAAATATTCT
ATCTATTCATTTTTGATTGAAGGAATTGAATGCAAGTGAAGAAGGAGAGATATTAGTTAA
TAAATGAAACTTTAAAATGAAAATGGTTGGTTTCAGCGCTATTCACGTTACTAATTACTT
GCAAAAGAATAATAATTTATTCAAATAAATTTTGCTCAATATAAAATAGTTGAGTAATGG
AGCATCATACCATTTTTTACAATTTAGCAAATGCTTGCTTATTATCCCTAATATATCAAT
CAATTATATAAGCCTTAAACAACTCTCGCTACTTCTTTTGCTTTCTCTTCTAAGGATCCC
ATTCATTTTTTGTTTTAATTTAATTTTTTTGATCTAAAATCGTTTTTATTTTTAAGGGTC
ATTTGACTGACAAATACACTGTCATTGATCACACCTATGATGCTATCGTTGTTGGTGCTG
GTGGTGCTGGTTTAAGAGCTGCTTTTGGTTTGGTTGAAGAAGGTTTCAAGACCGCTTGTA
TTACTAAGCTTTTCCCTACTCGTTCTCACACAGTCGCTGCTTAAGGTGGTATTAACGCTG
CTTTAGGTAATATGACAGAAGATGACTGGAAATGGCATTTTTATGATACAGTTAAGGGTT
CTGATTGGTTAGGTGATTAAGATGCTATCTAATATATGACTAGAGAAGCTCCCGCTGCCG
TCTTAGAATTAGAATCTTACGGTCTTCCCTTCTCTCGTACTCCTGAAGGCAAGATCTATC
AAAGAGCCTTCGGTGGTCAATCCCTCAAGTTCGGCAAGGGTGGTTAGGTATTAAATTAAA
TCATTAAACATTTAGAAGCACATTAGAGATAAAAGCATTGATACTTTTTAAGAGTACCAC
TTCATATCTATTAACCTAAAAAGTATAAGAAAAGCGAATTTCACAAACATTATGGAATAA
TTTGATACTACTAACAAAATTAAGTTTGGAGCATTTCAATATAAAAACATTTTAATTATT
AGATTCAATCTTTAAAAGGTTTCATTCATTCATTTATTCATACATATTTAATATGAAAAA
CGGGAATTTATTAAAAAGTTTACTATCTAAATAGAATATTAACAATAAAAACATAAAGAC
TAATAAAAGCTTGAAGCATCCAATTATCTACTCAGATTTTTAAGATTCATTTTAGAAAAT
TCGATAATTAAAAGACAGCCAAGTAAGAAAGCAAATAAATAAATAAACAAACAAACAAAT
CTTAAAAATGAATATTACAAAGCATCAAATATTTTTTAAAATGTGATTCAAAAAAGAAAG
CAAATGAAAAGGAAAGAATGAAAATTGACAAATCAAGAAAAGTGGAAATTAATTATATAA
TAAATCGAATTAGTAGATGAAAATTAAAACAGAATTTTCGTGAAGTGGTGTAAATTAGAA
ATTTCTACTTTACAAAAAATTAATTTGATGCTACTTTCTATTATATTTTATAAAATAATT
ACACAAATTAAAAATTATTAAACTTGATCAGTAATTAAAATATTACTTAAATAACTTGCT
TAGTCTAATCGTTCAATTATTGTTTTATTTGATATTATTTTTAACGATTTTTTATTAAAT
TAAGGCAAGAAGAACTGCTTGTGCAGCTGATAGAACTGGACATGCTATGTTACATACTTT
ATTCGGAAGATCCTTAGCTTATAATTGCAATTTCTTTATTGAATATTTCGTTATTGACTT
AATTATGGATGAAGAAGGTGCCTGCAGAGGTGTCATCTGTATGTCTATGGCTGATGGTTC
TATTCACAGAATCAGAGCCCATTACACTGTATTGGCTGCTGGTGGTTACGGTAGATCTTA
TCTTTCTTGCACTGCTGCTCACACCTGCACTGGTGATGGTATGGCTCTTGCTACTAGAGC
TGGACTTCCTCTTGAAGATCCTGAATTCGTTTAATTCCATCCTACTGGTAATTTGCATTA
TTTATGATTAATTAGTAGATTTCTTAATTAATTCTATAATTAAAAATTAGGTATCTACGG
TTCTGGTTGTTTGATGACCGAAGGTTGCAGAGGTGAAGGTGGTATCCTTGTTAACAGTAA
TGGTGAAGCTTTCATGGAAAAATATGCTCCCACTGCTAAGGATCTTGCTTCCAGAGATGT
CGTCTCTAGAGCTATGACTATTGAAATCCTTGAAGGTAGAGGTGTTGGCCCTAAGAAGGT
ACCTAATATAAATTGATTTATTTTTTTTATTTTATTGAAGAATCTTTTATTATTTTTAAA
AAGGATCACATTTTCTTATAATTACATCACTTGAGTCCTGAAACTTTACATTAGAGATTA
CCTGGTATTTCTGAAACTGCCAGAATTTTCGCAGGTGTTGATGTTACCAAAGAACCAGCT
CCTGTCGTTCCTACCGTTCACTACAATATGGGTGGTGTTCCCACTAACTGGAAGACTGAA
GTTATTACCCAAGACAAGAATGGAAAGGACAAGGTATTTAAATATATTTAAGTATGCATA
AACATAGATTAAAAATTTTCAATTATAATTAAAGATTGTTCCTGGTTTGCTTGCTGCTGG
TGAAAACGCTTGTGCTTCTGTCCACGGTGCTAACAGACTTGGTGCTAACTCTCTTTTAGA
TATTGTCGTTTTCGGTAGAGCTGCTGCCAAACTTGTTAAGGAAAAGCTTAAACCTGGTAC
TCCTCATAAGGATTTACCCAAGAATGCTGGTGAATAAGCTTTAGCCAGATTAGATAAATA
CAGATTTGCTAATGGTGAATACACTACTCACCACGTTAGAACTGCTATGTAAGAAACCAT
GTAACGTCACGCAGCTGTCTTCAGAATTGAAAAGCTTATGGCTGAAGGTGTTCAAAAATT
AGATCACATTTATGAATAATCAAAGAGCCTTAAAACCTTCGACAGAGGTCTTGTTTGGAA
CACTGATCTCATTGAAACCTTAGAATTAGAAAACCTTCTTTGTAAATAATTCATTTATTA
ATTTATATATAACTAATTAATTAATTAAAAATTAAAATCTTAGTATGCTCTAAATAAACT
CTTCTCGCTGGTTTACTCAGAAAGGAATCCAGAGGTGCTCACGCCAGAGACGATTTTAAG
GTAAATTTATAAGAAATTTATTTTTAATCCTGTAAATAAAATTAAATTGTAAAAATAGGA
AAGAGATGATAAGAATTGGATGAAGCACAGTCTCACTTGGATTAAAGATGTAAATACTGG
TAAAACTGAAGTAACCTATAGAGATGTCATCAACCACACTCTTGATAGTGAAGTTACTCC
TGTTCCTCCCGCTAAAAGATCATATTGA