Identifiers and Description

Gene Model Identifier

TTHERM_00106960

Standard Name

SCL1 (20S proteasome core alpha subunit 1)

Aliases

PreTt23090 | 7.m00566

Description

20S proteasome core alpha subunit 1

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 10.6%

TetraMine Data

TTHERM_00106960

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_00421.18.997766383757294e-176proteasome A-type and B-type f
amily protein (246 aa)
DictyBaseDDB_G02788471.0002758036576784e-62psmA6 on chromosome: 3 positio
n 1274786 to 1275953
SGDYGL011C5.9995872346509964e-61SCL1 Alpha 1 subunit of the 20
S proteasome involved in the d
egradation of ubiquitinated su
bstrates; 20S proteasome is th
e core complex of the 26S prot
easome; essential for growth;
detected in the mitochondria
OxytrichaContig17068.0.g822.0007467515522948e-59Proteasome subunit
WormBaseWBGene000039222.9987037581344066e-55locus:pas-1 Proteasome subun
it alpha type-6 status:Confi
rmed UniProt:O17586 protei
n_id:CAB02738.1
Stentor CoeruleusSteCoe_74416.054601895401186e-39

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00106960(protein)
MSGSETQITVFSPEGRLFQVEYAQRAVKNSGITTIGVRGKDCVVLITEKKTQESYVDMNS
FTNIHTVSERVGAATTGYYPDSKAIVTRLRQEASEYKLKNGHFMPVDQLSCRLGDLSQVY
TQKAFMRPYAVETILAGYDNELGPLLYKNDPSGYFCGYRAVASGIKEQDAIHQLEKEFKK
DKNATSMSFDKTIEVAINTLKNILNREFNPTDIEIGVVSKEQPKFKKLNEQEIEEALRRT
NQSKQ


>TTHERM_00106960(coding)
ATGAGCGGATCAGAAACCCAAATTACAGTTTTTTCACCTGAAGGAAGACTCTTCTAAGTA
GAATATGCTTAAAGAGCTGTTAAAAACTCTGGTATCACTACTATTGGTGTCAGAGGTAAG
GATTGTGTTGTTTTAATTACCGAAAAGAAGACCTAAGAAAGTTATGTAGATATGAATTCC
TTCACTAATATTCACACCGTAAGCGAACGTGTTGGTGCTGCTACCACCGGTTATTACCCT
GACTCTAAAGCCATTGTAACCAGACTTAGATAGGAAGCCAGTGAATATAAGCTTAAAAAT
GGTCACTTCATGCCTGTTGATTAGCTCTCTTGCAGATTAGGTGATTTATCCTAAGTTTAT
ACTCAAAAGGCTTTCATGAGACCTTACGCTGTTGAAACTATTCTTGCTGGATATGACAAC
GAATTAGGTCCTTTACTTTATAAGAACGATCCTTCTGGTTACTTCTGTGGTTACAGAGCT
GTTGCATCAGGTATTAAGGAACAAGATGCTATCCATTAATTAGAAAAGGAATTTAAAAAA
GATAAGAACGCCACTTCCATGAGCTTTGATAAAACTATAGAAGTTGCCATCAATACTTTA
AAAAATATTCTTAACCGTGAATTCAATCCTACTGATATTGAAATTGGTGTTGTAAGTAAA
GAATAACCTAAATTCAAAAAGCTTAACGAATAAGAAATCGAAGAAGCTCTCAGAAGAACT
AACCAATCAAAGTAATGA


>TTHERM_00106960(gene)
ATGAGCGGATCAGAAACCCAAATTACAGTTTTTTCACCTGAAGGAAGACTCTTCTAAGTA
GGTAAATGAAGTTATAATCGATTTAAATATAGCAAGCTATATGTTCAATTAAAATTTTGC
TCAAGAAGTCTTCACTATTCTAAAGTCTTACTGAAAGTTGCAATTAATAGAAATTAAAAA
CGATATATTTTGAGATCGAAAGAACAAAGAACAATTTTAAATGAAACAATTATTGATTGA
ATGTTGCAAAAATTAACTTTATTTATTTATAATTTAACAGAATATGCTTAAAGAGCTGTT
AAAAACTCTGGTATCACTACTATTGGTGTCAGAGGTAAGGATTGTGTTGTTTTAATTACC
GAAAAGAAGACCTAAGTACTTAATTTATTCATTCATTGATTTAAAAGCGATCCAAAAGCC
TTTTTAGATAAAATGAAATTTTACAAAATGATTTTTGTTAAATTTTGTTTAGAATTAGAA
GTTAATAAGCTTTATTTGGTTAAAATTTTATTGTAATATTATCAGGAAAGTTATGTAGAT
ATGAATTCCTTCACTAATATTCACACCGTAAGCGAACGTGTTGGTGCTGCTACCACCGGT
TATTACCGTAATTCTTATTTAAAATATATATATGCGTATTCAATTACTAAACCATTTAAA
TAAATTTAATTTTTAATGAAATTAGCTGACTCTAAAGCCATTGTAACCAGACTTAGATAG
GAAGCCAGTGAATATAAGCTTAAAAATGGTAAAAATATGACAACGTAATTTAAAAAATCT
AAAGTATTTTTGAATTAATTTAGGTCACTTCATGCCTGTTGATTAGCTCTCTTGCAGATT
AGGTGATTTATCCTAAGTTTATACTCAAAAGGCTTTCATGAGACCTTACGCTGTTGGTAT
ATATTAATAATTCTTAAACTCATTATAATAAAGATTACAAAAATTTCTAAATAACATTAT
AATTTACTATATAAATAAAGAAACTATTCTTGCTGGATATGACAACGAATTAGGTCCTTT
ACTTTATAAGAACGATCCTTCTGGTTACTTCTGTGGTTACAGAGTAATTAAATATTTTTT
ATTTCAAATTTTTAAACTTTTAAAATTCAAAATCTATTTAAAGTAAGTTATATGTAGTGC
TAATGAATGAATAATTTAGTAGGTTTGATAAAATACTTAAATAGCAAATGAATTTTGGTT
TGTTTATAATAGCCATTTTGAAATAAATTTAAATTTTAATCTAATTTTAAATAATTTAAA
GGCTGTTGCATCAGGTATTAAGGAACAAGATGCTATCCATTAATTAGAAAAGGAATTTAA
AAAAGATAAGAACGCCACTTCCATGAGCTTTGATAAAACTATAGAAGTTGCCATCAATAC
TTTAAAAAATGTAATTATCAATATATTTTTTGAATTATATCCACAAATAAATTTATTTAT
TTATTAAATTATTTTATAGATTCTTAACCGTGAATTCAATCCTACTGATATTGAAATTGG
TGTTGTAAGTAAAGAATAACCTAAATTCAAAAAGCTTAACGAATAAGAAATCGAAGAAGC
TCTCAGAAGAACTAACCAATCAAAGTAATGA