Identifiers and Description

Gene Model Identifier

TTHERM_00825540

Standard Name

SBP1

Aliases

PreTt04018 | 142.m00115 | 3683.m00048

Description

fructose-1,6-bisphosphatase family protein,Sugar phosphatase; SBPase; hydrolyzes the 1-phosphate of sedoheptulose 1,7-bisphosphate

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00316 ) fructose-1,6-bisphosphatase

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 12.1%

TetraMine Data

TTHERM_00825540

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_18264.19.997093137033517e-262fructose-1,6-bisphosphatase (3
09 aa)
OxytrichaContig2324.0.g37.999607936310296e-81Fructose-1-6-bisphosphatase
WormBaseWBGene000014047.002785992501305e-33locus:fbp-1 status:Confirmed
UniProt:G5EBJ7 protein_id
:CCD68127.1
DictyBaseDDB_G02708367.001594317853847e-31fbp on chromosome: 1 position
3681011 to 3682051
SGDYLR377C1.9996410647472548e-29FBP1 Fructose-1,6-bisphosphata
se, key regulatory enzyme in t
he gluconeogenesis pathway, re
quired for glucose metabolism;
undergoes either proteasome-m
ediated or autophagy-mediated
degradation depending on growt
h conditions; interacts with V
id30p
Stentor CoeruleusSteCoe_290908.533047625744066e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00825540(coding)
ATGGAAACTCATACTCATCTAGTTTTTTCAGACTGCGAGAGTCTTTAGAAAATATACATT
GCTCTCCTTGACTCTTTTATTGAGCTTGCTGACCTTCTTAGATTCCATGCCTGTGGAAGA
AAGGAAGCTGGCTCATAAAACGCATTTGGAGATATTTAACTCGAATGTGATACAAAAAGC
GATGAAATTATTTTCAATCATTTGAAAAAAACTGGAGAAGTTGCATATGGTTTAAGCGAG
GAACAACCAAAGCTTGTAGAATTAGGAGGAAATAAATATATTGTTACATTTGATCCATTA
GATGGAAGCTCAATTATTGGTTGCAATTGGACAGTAGGAACAATTTTTGGTATATGGAAA
AATGATGAGAAGGTTTTGATAGGTCACAAGACAAAAGATTTAATTGCATCTGGATGTTGC
ATGTATGGTCCTAGAACTACAGCTGTGATATATAACGAAAAAACTAAAACAGTGAATGAA
TATTCTTTAACATTGAATAAATAAAAGCAAGTTGAATGGATTTTATCATTGCCTAACATT
GTTATTAAACCTTAAGGAAAGTTATTTGCTCCAGGAAATTTAAGGGCTGCAAGTGAAAAT
CCTAACTATAGATAATGCATTAATAACTGGATTGATTAAGGATATACTTTAAGATATACA
GGCGGTATGGTTCCTGATATTTATTAGATTTTCATTAAAGGCTCTGGTATTTTTACTACT
ATTTCCTCAAAAAGCCACGCTGTCAAATTAAGAGTATTATATGAAGTTGCTCCATTGGCA
CATCTTGTTGAAATGGCAAAAGGTAAAAGCAGTGATGGAAAAAATTCACTAATGGAATTG
GAAGTTACATCTTACGATCAACGCTCAGGAATTATTGTTGGAAGTACAGAAGAAGTTGAT
AAAATTTTATCAACCTTAAATTCTTGA


>TTHERM_00825540(protein)
METHTHLVFSDCESLQKIYIALLDSFIELADLLRFHACGRKEAGSQNAFGDIQLECDTKS
DEIIFNHLKKTGEVAYGLSEEQPKLVELGGNKYIVTFDPLDGSSIIGCNWTVGTIFGIWK
NDEKVLIGHKTKDLIASGCCMYGPRTTAVIYNEKTKTVNEYSLTLNKQKQVEWILSLPNI
VIKPQGKLFAPGNLRAASENPNYRQCINNWIDQGYTLRYTGGMVPDIYQIFIKGSGIFTT
ISSKSHAVKLRVLYEVAPLAHLVEMAKGKSSDGKNSLMELEVTSYDQRSGIIVGSTEEVD
KILSTLNS


>TTHERM_00825540(gene)
ATGGAAACTCATACTCATCTAGTTTTTTCAGACTGCGAGAGTCTTTAGAAAATATACATT
GCTCTCCTTGACTCTTTTATTGAGCTTGCTGACCTTCTTAGATTCCATGCCTGTATTTCT
CTTTAATTATTTAGATTTCTTAAGCTAATGATATACATATATATATATATATATTACATA
AAGGTGGAAGAAAGGAAGCTGGCTCATAAAACGCATTTGGAGATATTTAACTCGAATGTG
ATACAAAAAGCGATGAAATTATTTTCAATCATTTGAAAAAAACTGGAGAAGTTGCATATG
GTTTAAGCGAGGAACAACCAAAGGTATGTTTTAAATTTTATAATAGTAAACTTCAACATA
TCGCATAAAATATTTAGCTTGTAGAATTAGGAGGAAATAAATATATTGTTACATTTGATC
CATTAGATGGAAGCTCAATTATTGGTTGCAATTGGACAGTAGGAACAATTTTTGGTATAT
GGAAAAATGATGAGAAGTAAATTTATATTCAAAGATATTGCTTATTATCTTAAAATTTAT
TTACAACTTAGGGTTTTGATAGGTCACAAGACAAAAGATTTAATTGCATCTGGATGTTGC
ATGTATGGTCCTAGAACTACAGCTGTGATATATAACGAAAAAACTAAAACAGTGAATGAA
TATTCTTTAACATGTAATTAAAAAAAATTTTCTAAATAGACTTACATAAGTAATCAAATT
AAATTTAATTAAGTGAATAAATAAAAGCAAGTTGAATGGATTTTATCATTGCCTAACATT
GTTATTAAACCTTAAGGAAAGTTATTTGCTCCAGGAAATTTAAGGGCTGCAAGTGAAAAT
CCTAACTATAGATAATGCATTAATAACTGGATTGATTAAGGATATACTTTAAGATATACA
GGCGGTATGGTTCCTGATGTATATTTTACAAATGATAACTAATTTAAAAGAAAATTAACA
AGTTTTTTATAAATAGATTTATTAGATTTTCATTAAAGGCTCTGGTATTTTTACTACTAT
TTCCTCAAAAAGCCACGCTGTCAAATTAAGGTATTATTTTTTTTATCTTACTTTATTTAA
TAATAAATACTTTTTTTAATCTCAAAAATACATTAAAGTTATTGTTTTAATTAATAATTT
TGAATAAATTTTAGTTATAGAAAGTACATTTTACAAATATTTTGTGTAAGTATTTCTTAC
AATCTTTCTAATTATTATAATTCAATAACGTCTTTTTAATTTTCTATCTGTCTGTTATAA
TTATTTAGAATTCAATAGCTAATTTAAGTTTTTATCTGTTATTTTTTTCTTATTTTAAAT
GTTATTTCTTAAAGAGTATTATATGAAGTTGCTCCATTGGCACATCTTGTTGAAATGGCA
AAAGGTAAAAGCAGTGATGGAAAAAATTCACTAATGGAATTGGAAGTTACATCTTACGAT
CAACGCTCAGGAATTATTGTTGGAAGTACAGAAGAAGTTGATAAAATTTTATCAACCTTA
AATTCTTGA