Identifiers and Description

Gene Model Identifier

TTHERM_00388200

Standard Name

SAS6A

Aliases

PreTt24815 | 41.m00222

Description

basal body protein; identified in proteomic analysis

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF02370 ) M protein repeat
  • ( PF08647 ) BRE1 E3 ubiquitin ligase
  • ( PF04702 ) Vicilin N terminal region
  • ( PF06428 ) GDP/GTP exchange factor Sec2p
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( PF05890 ) Eukaryotic rRNA processing protein EBP2

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

TetraMine Data

TTHERM_00388200

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_04443.19.997093137033517e-262hypothetical protein (701 aa)
Stentor CoeruleusSteCoe_203431.3336148155022614e-34
OxytrichaContig12356.0.0.g598.99682777598231e-22Protein of unknown function (D
UF501)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:17785518: Kilburn CL, Pearson CG, Romijn EP, Meehl JB, Giddings TH, Culver BP, Yates JR, Winey M (2007) New Tetrahymena basal body protein components identify basal body domain structure. The Journal of cell biology 178(6):905-12

Sequences

>TTHERM_00388200(coding)
ATGGATAGTTTATCTTAAAAGTCTGGAAGAAGCTAGCAATAGAATTACTCTCATCAATAA
ACTCCTGCTAGGAATTTAAATGGCTCTTATCAAAATTAACATCAAATTCAAAATAACGAT
TTTTAAAGCTCATAGAAACAAAAATACGAAAAGAACTTAAATTAAAGTGGATTTATTCAA
CCAATTAGCGTGCATCCACTCCAATCAGATGGGTTTTAGCAACCAAAAGATATTTATGAT
AATCAAATAACAATGAAATTGAAATCACATGAAAGAGAAGACTAATTAACCTGCTTAAAT
CTTAAAATAATACTTAATCCAGGTAACAATATTCATGGTCAAGTCCTTTAGATGGAATTA
ACTGATGAACTCAACTAATTGTTCCTTTACATTTTGTAACTTAGTGAAACTGATTTCTTG
CAAGTAAAAAATGACTAAAACTTAATTGTGGATTTCAATGGATTCCCAACTAAGCTTATT
GAACTTTTGGAATTGTCTCTTAACTCTAATAAAGAAGACAAAATATAGTTTGCATGTGTT
TTTGAAATTAAATCGAATGGTGAAGGTTTTTTAAAAATAACTGAGATGAATCAATTTAAA
ACATTAGTCCATTTAGCATTAAAATTCAGATGTGCCAATGATGAAGTTTTAAAAAATTAC
TTAGCAAATAAACTAACCAAAGAATAAAATGAAAATGAAGAATTGAGAATCAAGAATTCC
AGAATCGAAGAATAACTGTAAGATTCTCAAAATAAAAATGAAGAATTAAACCAACAATTA
GCACGCTTTTAGTAAGAAAGAGAGCAATAAGAAGAGTAGCTTAGACTTGAATCTTCAAAG
AAGCTCCATCTTCAAAAAGAAGAGTACTTACAAAGAGAAAGTGAACTTAGAAATACATAT
GAATCAAAGCATTAACTCATACAAGAAAGATTAGAAAAACAAATTTAAGATTTACAAAAT
TAAGTTCAAAGTCTTTAGAAGTAAAATTCAGATCTGAACGAAGTAAAACTTAATTTAGAT
TCATCAGTCAGAGAACTTTAAAGCAAAAATAAAGTAAATGAGAAAGAATTAGACATAGTA
AATAAAGAAATTTAAACTTTAAGACTAGACAACAAAAATCTTGATAGCGTTCGTTTTGCA
CAAGAAAAAAAAATTACAGAATTAACTGTAAAAATTGAAAGCTTGGAAAAATAAATCATT
GATAAAGATTAGTTAATCAGCAGTTCAAAGTCCTTAAATTCAAACAACGAAGATTAAAAA
AAAATGCTTGAAAAGGAACTTAATGAAAAAAATCAGTCAATAGATAAGCTAGAAAAGAAA
TTAGAATAATGCAAGGTTGAAATCGAAAAAGGAAACGATGTCATAGATAAAATTCGTGAA
GCTCTTGAAAAGAAGAAAAAGAAATAGAAATAAAAAGAAGCTATTATTCTACAACAGGAG
TAAAACATACAAAATTTGCAAAATAGCATCGACACATTAAATAGATAGATAATAGAAATA
TAAAGAGAAAAAGATAACTCTGAAATAAAAGTAAAAGAACTTCAAACAGCTAATTCTGAT
CTTAAAACTAAAATCTAAGAGTCATAAAAAGTTTTAGAATAGAATCAATCAATGATTCAA
TACTTAAATAATTAATTGAACAATACAAGACCTAATATCCCTACAGGATTGTCTTCCACT
TTAGCAGGATAAACTTCAAGTGCTTATAGACCTAATTATGCTGCAACCTCTACTATTTCT
CATACTAAATATGGAACTTATGCCAATAATTTTGGTGGTGAAGATAGATATACATAAGAT
CATCCTCGCTCTCATACACCTCTAAGCTACAGCCAAAAAAATAACAATCCTTTGCAGTAC
ACTAATCTATATAGTTAAAGTTTAAATTAAGGTGCCACATATCATTTAACTAAATCTCCA
CTTACAAAAGATTTTGATTATGATAATGAAGAAAAAGGATAGGAAAATCATACAAACTTA
AATACAAAATACACAGCTACTCTTGGTGGTTAAAGAAACAGCAATAGTTTTAGTGTAAAC
AACACAATAAGTGCTGTTGGAGAAGGAAATATTGTTCCAATAAAATATCGTGATCCAACA
AAAAATTAGTGA


>TTHERM_00388200(protein)
MDSLSQKSGRSQQQNYSHQQTPARNLNGSYQNQHQIQNNDFQSSQKQKYEKNLNQSGFIQ
PISVHPLQSDGFQQPKDIYDNQITMKLKSHEREDQLTCLNLKIILNPGNNIHGQVLQMEL
TDELNQLFLYILQLSETDFLQVKNDQNLIVDFNGFPTKLIELLELSLNSNKEDKIQFACV
FEIKSNGEGFLKITEMNQFKTLVHLALKFRCANDEVLKNYLANKLTKEQNENEELRIKNS
RIEEQLQDSQNKNEELNQQLARFQQEREQQEEQLRLESSKKLHLQKEEYLQRESELRNTY
ESKHQLIQERLEKQIQDLQNQVQSLQKQNSDLNEVKLNLDSSVRELQSKNKVNEKELDIV
NKEIQTLRLDNKNLDSVRFAQEKKITELTVKIESLEKQIIDKDQLISSSKSLNSNNEDQK
KMLEKELNEKNQSIDKLEKKLEQCKVEIEKGNDVIDKIREALEKKKKKQKQKEAIILQQE
QNIQNLQNSIDTLNRQIIEIQREKDNSEIKVKELQTANSDLKTKIQESQKVLEQNQSMIQ
YLNNQLNNTRPNIPTGLSSTLAGQTSSAYRPNYAATSTISHTKYGTYANNFGGEDRYTQD
HPRSHTPLSYSQKNNNPLQYTNLYSQSLNQGATYHLTKSPLTKDFDYDNEEKGQENHTNL
NTKYTATLGGQRNSNSFSVNNTISAVGEGNIVPIKYRDPTKNQ


>TTHERM_00388200(gene)
ATGGATAGTTTATCTTAAAAGTCTGGAAGAAGCTAGCAATAGAATTACTCTCATCAATAA
ACTCCTGCTAGGAATTTAAATGGCTCTTATCAAAATTAACATCAAATTCAAAATAACGAT
TTTTAAAGCTCATAGAAACAAAAATACGAAAAGAACTTAAATTAAAGTGGATTTATTCAA
CCAATTAGCGTGCATCCACTCCAATCAGATGGTAAATACAAAAAATCATGAATAGAATAA
GGTTTTAATGTTTTTATTTTAATGATTCTTATTTATAGGGTTTTAGCAACCAAAAGATAT
TTATGATAATCAAATAACAATGAAATTGAAATCACATGAAAGAGAAGACTAATTAACCTG
CTTAAATCTTAAAATAATACTTAATCCAGGTAACAATATTCATGGTCAAGTCCTTTAGAT
GGAATTAACTGATGAACTCAACTAGTAATTTACAATAATATTTTATTGAATACCTAATTT
TGAATTTTGATATAATGTTACAATTAACAAATAAATTAATTTTATAATTGCATTTCAAAA
ATATTAATAATTAAATTAAACTATTTTAGCTGATGTCCCATTTAGTTGATTTTGTTTTGT
TTTAAAATTTTTTTTTAAATAAACTATTTAGATTGTTCCTTTACATTTTGTAACTTAGTG
AAACTGATTTCTTGCAAGTAAAAAATGACTAAAACTTAATTGTGGATTTCAATGGATTCC
CAACTAAGCTTATTGAACTTTTGGAATTGTCTCTTAACTCTAATAAAGAAGACAAAATAT
AGTAAGATCTTACATACCTCAAAATTTTCTCAATAATTAATTTTTTTAATTTAGTTAATA
TTTAATATAAAATTTATAAATAGGTTTGCATGTGTTTTTGAAATTAAATCGAATGGTGAA
GGTTTTTTAAAAATAACTGAGATGAATCAATTTAAAACATTAGTCCATTTAGCATTAAAA
TTCAGATGTGCCAATGATGAAGTTTTAAAAAATTACTTAGCAAATAAACTAACCAAAGAA
TAAAATGAAAATGAAGAATTGAGAATCAAGAATTCCAGAATCGAAGAATAACTGTAAGAT
TCTCAAAATAAAAATGAAGAATTAAACCAACAATTAGCACGCTTTTAGTAAGAAAGAGAG
CAATAAGAAGAGTAGCTTAGACTTGAATCTTCAAAGAAGCTCCATCTTCAAAAAGAAGAG
TACTTACAAAGAGAAAGTGAACTTAGAAATACATATGAATCAAAGCATTAACTCATACAA
GAAAGATTAGAAAAACAAATTTAAGATTTACAAAATTAAGTTCAAAGTCTTTAGAAGTAA
AATTCAGATCTGAACGAAGTAAAACTTAATTTAGATTCATCAGTCAGAGAACTTTAAAGC
AAAAATAAAGTAAATGAGAAAGAATTAGACATAGTAAATAAAGAAATTTAAACTTTAAGA
CTAGACAACAAAAATCTTGATAGCGTTCGTTTTGCACAAGAAAAAAAAATTACAGAATTA
ACTGTAAAAATTGAAAGCTTGGAAAAATAAATCATTGATAAAGATTAGTTAATCAGCAGT
TCAAAGTCCTTAAATTCAAACAACGAAGATTAAAAAGTATATTCTATTATTAAATATTAT
TGATAATAGTTGTAAATAAATTATTTTAAAATTCAGAAAATGCTTGAAAAGGAACTTAAT
GAAAAAAATCAGTCAATAGATAAGCTAGAAAAGAAATTAGAATAATGCAAGGTTGAAATC
GAAAAAGGAAACGATGTCATAGATAAAATTCGTGAAGCTCTTGAAAAGAAGAAAAAGAAA
TAGAAATAAAAAGAAGCTATTATTCTACAACAGGAGTAAAACATACAAAATTTGCAAAAT
AGCATCGACACATTAAATAGATAGATAATAGAAAGTAATATAGTTATTCTATTAATTTGA
ATAGAGTTTTAAATTAACAAGTTTTCAATTAAAATTTTTTATTTTTATTTAAAGTGATTC
TTTAGAGTTGTTCGATATTTTATTTTATTTTTTGAGATATCTTTATTTTGAAAATAGAAT
ATCGACACTCGATATATCAACTCATTTTATATGATTTACCCAAAATAAAATATAAAAATT
AAATTCGATGGGATATGAATATTTTAAAAATGAAATATTGAAGTTGAATATATTTAAAAT
CAAATATATTAATTAATCCAGCTCAATCAATTTGATTTAAATTTAAACAATACTTAAATA
TTATTTATATATTTCAGATTTTATTAAAATAATTTTTTTAATAAGATATTACTTTTTTAT
CATAATTTAAATAATTCTTAGTTTGAAAAATATTATTTTTTATTTAAAATTTTAATTTTT
ATTAAATAGTATAAAGAGAAAAAGATAACTCTGAAATAAAAGTAAAAGAACTTCAAACAG
CTAATTCTGATCTTAAAACTAAAATCTAAGAGTCATAAAAAGTTTTAGAATAGAATCAAT
CAAGTAGGATTTAATTTAATTGTTTTAGATAGTTAAAATTATTTTTATTATAAAAAGTGA
TTCAATACTTAAATAATTAATTGAACAATACAAGACCTAATATCCCTACAGGATTGTCTT
CCACTTTAGCAGGATAAACTTCAAGTGCTTATAGACCTAATTATGCTGCAACCTCTACTA
TTTCTCATACTAAATATGGAACTTATGCCAATAATTTTGGTGGTGAAGATGTAATAAGTT
ATTTTTAAATAAAATTTGAAATTTATTTTAAAATCATTAACAGAGATATACATAAGATCA
TCCTCGCTCTCATACACCTCTAAGCTACAGCCAAAAAAATAACAATCCTTTGCAGTACAC
TAATCTATATAGTTAAAGTTTAAATTAAGGTGCCACATATCATTTAACTAAATCTCCACT
TACAAAAGATTTTGATTATGATAATGAAGAAAAAGGATAGGTAAAATTAAAAATTTATAA
ACGAATATTAAAAATAAATTTTTATACTTAGGAAAATCATACAAACTTAAATACAAAATA
CACAGCTACTCTTGGTGGTTAAAGAAACAGCAATAGTTTTAGTGTAAACAACACAATAAG
TGCTGTTGGAGAAGGAAATATTGTTCCAATAAAATATCGTGATCCAACAAAAAATTAGTG
A