Identifiers and Description

Gene Model Identifier

TTHERM_00392980

Standard Name

SAP30

Aliases

PreTt23526 | 42.m00260 | 3813.m01482

Description

histone deacetylase complex subunit SAP30 Sin3-binding protein

Genome Browser (Macronucleus)

GBrowse

Genome Browser (Micronucleus)

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

  • Tetrahymena Functional Genomics Database:

Change in Gene Expression

TMHMM

TMHMM

Signal Peptide

Signal Peptide Present?: No
Presense Probability: 9.8%

TetraMine Data

TTHERM_00392980

WebApollo

Fullscreen View

Tetrahymena Stock Center

No Data fetched for StockID

Homologs (v.2006 protein sequences)

SourceIdentifierScoreDescription
Tetrahymena borealisEI9_11500.16.000481660141652e-51hypothetical protein (96 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00392980(coding)
ATGAGCAAAAGCAATCAACCATAAGAAGACTTAGAAGAATAATACCTTCCAGATTTTACT
AAATTATCAAATGCCTCATTGCAAAAATACAGAATGTATTACAATATAGAATGTACTGAA
GAAGAGCTTGTAGAGAAAGTTAAAAAACACTTCAAATCCACCCTAGACATAAATTCGCTT
TAGTTATATGAAAAGATATTCAAGTTGAAAAGAGAAGAAAGAGAAGAATTAAAAAACAGG
AAGACTTTAAGAACAAAGAAAGAAATCTAAAAATCTAATTTTTGA


>TTHERM_00392980(protein)
MSKSNQPQEDLEEQYLPDFTKLSNASLQKYRMYYNIECTEEELVEKVKKHFKSTLDINSL
QLYEKIFKLKREEREELKNRKTLRTKKEIQKSNF


>TTHERM_00392980(gene)
ATGAGCAAAAGCAATCAACCATAAGAAGACTTAGAAGAATAATACCTTCCAGATTTTACT
AAATTATCAAATGCCTCATTGCAAAAATACAGAGTAAGTTTATTGTTTTGTGATTATACT
ATCATCGCAAATTTGTAAAGTGGTGGTGACATATTTATTAAGCTTCATTTTTAATAACAA
TTTAGATGTATTACAATATAGAATGTACTGAAGAAGAGCTTGTAGAGAAAGTTAAAAAAC
ACTTCAAATCCACCCTAGACATAAATTCGCTTTAGTTATATGAAAAGATATTCAAGTTGA
AAAGAGAAGAAAGAGAAGAATTAAAAAAGTAAGTTTTTAATAGTAAGTATGAAGGTTTAA
TATTTATTATTCTATATTTTAATTTAACAGCAGGAAGACTTTAAGAACAAAGAAAGAAAT
CTAAAAATCTAATTTTTGA